DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-U and pigu-1

Sequence 1:NP_609238.1 Gene:PIG-U FlyBaseID:FBgn0032052 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_492189.2 Gene:pigu-1 WormBaseID:WBGene00011914 Length:421 Species:Caenorhabditis elegans

Alignment Length:392 Identity:118/393 (30%)
Similarity:199/393 (51%) Gaps:51/393 (13%)


  Fly    31 RVEFATPLNSHKRMQEGIFLLQSGIDPYLGDLVHESPLILSALSGLFQKYP-QFLPIFYIILDIC 94
            |||..:.:.|.:::::.|.::..|::|:....:|..||.|.....|....| ..||:| |.:|:.
 Worm    50 RVELTSVVYSFEKLKDSIAMVDDGLNPFEAKNMHFPPLTLHLFRFLLNTAPTMILPLF-ISIDVA 113

  Fly    95 TAALLYAMSLRFVKQKQDQQDKERKEYAKDTEELQFGPLDKLDIPELVIVAYLFSPLTVMSCIGM 159
            |..:|.:.:....:|.....                      .|.:|:...|.|:|:|::|...:
 Worm   114 TTWILSSAADVVWRQTHGSS----------------------SIRKLIFSLYAFNPITIVSTGIL 156

  Fly   160 TSTVISNLFLAFFFYCLVKGMLIPCLLVLAFETVRSFYPIVLIAPLLLVF-SRNSVRRGVAIAAL 223
            :.|||.|...|.....||......|.:::...:..:.||.:||:  .||| |..|:   |...:|
 Worm   157 SLTVIQNFVSAVILLSLVTDRPTICAILIGAWSSFTIYPFILIS--CLVFRSNGSI---VKFLSL 216

  Fly   224 FIVSCL--IVAVANYFVLN--SWNFLDGTLGFIFYFRDLQPNIGLFWYFFTEMFEHFRTMFLITF 284
            .:||.|  |..|...::||  |.|||......|..|..:|||.||:||||.::|||||:.:.::|
 Worm   217 VLVSALTTITFVGINYLLNNQSLNFLGPVYASILNFSSIQPNSGLYWYFFVQIFEHFRSFYTMSF 281

  Fly   285 QLNATVLYL---VPLSIKLRKEPLLLATVLVALMAVFRAYPSLGDVGFYLALLP---LWKRCWKF 343
                .|||.   :|::..:||:.:|..|::..|:::|..||:|..|...||.||   ::|:.:::
 Worm   282 ----VVLYFFMPIPITFLIRKDTILHFTIIGFLVSIFFPYPTLNQVSLLLAFLPVHDVYKKHFRY 342

  Fly   344 --MAHGFVVFTFFLVTLSMMGALWHLWIYAGSANANFYFGATLAFSTGQIFLITDLLFAHVKREF 406
              :..|.:|.|.||     |..:||:||.:.|.||||:||.|:.::...|.|:.|::|.:.:|:.
 Worm   343 TILIAGTIVSTVFL-----MPVMWHMWIVSSSGNANFFFGTTIVYNVALINLVMDMIFVYSRRQI 402

  Fly   407 CL 408
            .|
 Worm   403 DL 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-UNP_609238.1 PIG-U 10..386 CDD:284205 112/369 (30%)
pigu-1NP_492189.2 PIG-U 32..382 CDD:284205 112/369 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152595607
eggNOG 1 0.900 E1_KOG2552
Hieranoid 1 1.000
Homologene 1 1.000 H6553
Inparanoid 1 1.050 170 1.000 Inparanoid score I2728
Isobase 1 0.950 0 Normalized mean entropy S1982
OMA 1 1.010
OrthoDB 1 1.010 D1339553at2759
OrthoFinder 1 1.000 FOG0004158
OrthoInspector 1 1.000 T477212
orthoMCL 1 0.900 OOG5_129002
Panther 1 1.100 LDO PTHR13121
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R924
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.