DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-U and PIGU

Sequence 1:NP_609238.1 Gene:PIG-U FlyBaseID:FBgn0032052 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_536724.1 Gene:PIGU HGNCID:15791 Length:435 Species:Homo sapiens

Alignment Length:433 Identity:164/434 (38%)
Similarity:250/434 (58%) Gaps:19/434 (4%)


  Fly     8 LLLLGGAVRFYFCRTPLAPMIGNRVEFATPLNSHKRMQEGIFLLQSGIDPYLGDLVHESPLILSA 72
            :|::...||....|:.||..|..|||..:||:|.||:.||:.||..|:.||.|.:.||:|||:. 
Human     8 VLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIY- 71

  Fly    73 LSGLFQKYPQFLPIFYIILDICTAALLYAMSLRFVKQ--KQDQQDKERKEYAKDTEELQFGPLDK 135
               ||.....:..:.::|.|..||..||.....|.|.  |:.:...|..:||.|..||...|::.
Human    72 ---LFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEM 133

  Fly   136 LDIPELVIVAYLFSPLTVMSCIGMTSTVISNLFLAFFFYCLVKGMLIPCLLVLAFETVRSFYPIV 200
            ..||..|.:.||.:|.|::||:..::..|:|..:|||....:||......:.||..|.:|.||:.
Human   134 RYIPLKVALFYLLNPYTILSCVAKSTCAINNTLIAFFILTTIKGSAFLSAIFLALATYQSLYPLT 198

  Fly   201 LIAP-LLLVFSRNSV---RRGVAI-------AALFIVSCLIVAVANYFVLNSWNFLDGTLGFIFY 254
            |..| ||.:..|..:   .:..|.       |.:::.|.:::...::|:|:||:|:....|||..
Human   199 LFVPGLLYLLQRQYIPVKMKSKAFWIFSWEYAMMYVGSLVVIICLSFFLLSSWDFIPAVYGFILS 263

  Fly   255 FRDLQPNIGLFWYFFTEMFEHFRTMFLITFQLNATVLYLVPLSIKLRKEPLLLATVLVALMAVFR 319
            ..||.||||||||||.||||||...|:..||:| ...|.:||:|||::.|:....:.:|::|:|:
Human   264 VPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQIN-VFFYTIPLAIKLKEHPIFFMFIQIAVIAIFK 327

  Fly   320 AYPSLGDVGFYLALLPLWKRCWKFMAHGFVVFTFFLVTLSMMGALWHLWIYAGSANANFYFGATL 384
            :||::|||..|:|..|:|...::|:.:.||:....:|...:...||||||||||||:||::..||
Human   328 SYPTVGDVALYMAFFPVWNHLYRFLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITL 392

  Fly   385 AFSTGQIFLITDLLFAHVKREFCLFNGQKILI-DGEEARIVLK 426
            .|:.|||.||:|..:|.::||:.|.:|..:.. ||.||.:|||
Human   393 TFNVGQILLISDYFYAFLRREYYLTHGLYLTAKDGTEAMLVLK 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-UNP_609238.1 PIG-U 10..386 CDD:284205 144/389 (37%)
PIGUNP_536724.1 PIG-U 20..394 CDD:310970 142/379 (37%)
May be involved in recognition of long-chain fatty acids in GPI 269..289 16/20 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153085447
eggNOG 1 0.900 E1_KOG2552
Hieranoid 1 1.000
Homologene 1 1.000 H6553
Inparanoid 1 1.050 302 1.000 Inparanoid score I2644
Isobase 1 0.950 0 Normalized mean entropy S1982
OMA 1 1.010
OrthoDB 1 1.010 D1339553at2759
OrthoFinder 1 1.000 FOG0004158
OrthoInspector 1 1.000 T1074392
orthoMCL 1 0.900 OOG5_129002
Panther 1 1.100 LDO PTHR13121
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R924
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.