DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13097 and mphosph10

Sequence 1:NP_609237.1 Gene:CG13097 FlyBaseID:FBgn0032051 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001186500.1 Gene:mphosph10 XenbaseID:XB-GENE-940335 Length:719 Species:Xenopus tropicalis

Alignment Length:732 Identity:264/733 (36%)
Similarity:393/733 (54%) Gaps:108/733 (15%)


  Fly    14 KEIAENFEQLTKNPERFLQPQPEQVNAIEQLIQQTYAVSISEDVANKKELLPELVLEQMDEEQIW 78
            ::..|..|.::.:||:.|..|.|.......|.:..|.:..|:........|.:|::|..||||||
 Frog    13 EQCMEVLELVSAHPEQLLSVQDELATEFSCLTKALYDLQKSQLALEVGSPLEKLIIENFDEEQIW 77

  Fly    79 QQLEIRNELV---FQQVLEQTAR------LTAMREQHLGIELDDGEEIE-EEDEVI-QAEDSGDE 132
            ||||::|..|   |::.:.:|.:      :.:..|:...:|.:|.|.:. ||.|:| :.||....
 Frog    78 QQLELQNNAVLGYFKKAVSKTQKDKDIYLIQSTEEEPSELEYEDEEGVSAEESELISENEDEQRT 142

  Fly   133 EQDEESD-----------FSDEDGG--------LQKQ-KTAPPKDKRNKRLRNSVVDDTFFKLEE 177
            ::.:.:|           |||:|..        |:|| :..|.|....|....||:||.||||.|
 Frog   143 QKKKTADTKRPKRTPVEAFSDDDDSDMDFDIDKLEKQSQQIPNKKPMAKPSEKSVLDDKFFKLSE 207

  Fly   178 MNEFL---EQEDAKEMRRLNSKKRVEQADDIDHFAEDFGLGEDEEDDEEGNVN------------ 227
            |..:|   |:||::|          :..||:|:| ||....:|||::||.:::            
 Frog   208 MEAYLEKVEKEDSEE----------DDDDDVDYF-EDIDSEDDEEEEEEDDMDEDFNITKSKEQV 261

  Fly   228 --------YADFFDMNE-----ELTEHSKKINKGKQKDFFNENESENENEPDEDANPKEGDSDQS 279
                    |.||||..|     ::...:|...:.|::|.|.|::.|.:.|.|::....|.|.::.
 Frog   262 KKSSRDLQYQDFFDPVEGEEGCDIDPSAKNKKEEKEQDDFLEDDEEGDGEEDDEEGDGEEDDEEG 326

  Fly   280 EGDEGDDE--PENDQDPDEAASEIDESEFVAKSGIEPASDSDSDSE----------KEEEEPQPT 332
            .|:|.|:|  .:||:|.||...|.:||:...::......|...:||          |::|..:.:
 Frog   327 GGEEEDEEKMSKNDEDEDEQMEETEESQKAKETLKRVTFDLSDESEGEDVGDILGGKKKEISESS 391

  Fly   333 EPPSQSSNEMREARLFQRIRDYEDIVLGEKPWQLKGEVKAANRPQNSLLEEILDFDSTTRPTAPI 397
            |  .:||.|.||.::.::|:..:..:|.||.||..|||.|..||:||||.|.|.||..:|....|
 Frog   392 E--VKSSFEKREQKMAEKIQALQKNMLEEKQWQFSGEVTAQKRPENSLLSESLVFDHASRMAPVI 454

  Fly   398 TEEDNRSIEDIIKQRIRDKAWDDVERTVRPVNTPQEYRKQLVLDQEKSKQSLSQIYEAQYQREME 462
            :||....:||||||||:|:.||||.|..:|.....||:|:|.||.:|||.||::|||.:|.::.|
 Frog   455 SEETTMQLEDIIKQRIKDQLWDDVVRKEKPKENAFEYKKRLTLDHDKSKLSLAEIYEQEYIKQNE 519

  Fly   463 KLDPNRDADDKTGPEPKEHQEIKRAMRSLFLKLDALSNFHFTPKPVAPEIKIVTNTPAVHMEEVA 527
            |   |::.::    .|| |.|:::.|.||||||||||||||.|||..|:||:|:|.||:.|||||
 Frog   520 K---NKEEEE----NPK-HMEVQKMMDSLFLKLDALSNFHFIPKPPVPDIKVVSNLPAISMEEVA 576

  Fly   528 PLAVSDAKLLAPEEVFRGPKHAPLGKT--ERDRTDKNRERRKKKQKQRAIHSALEQRELQ----R 586
            |:.||||.||||||:....|...: ||  |:..|||.|||||||..::......|:|:.|    |
 Frog   577 PVNVSDATLLAPEEIKEKNKAGDI-KTNAEKTITDKKRERRKKKAIKKQKIKEREERKKQADKIR 640

  Fly   587 AKEG-KAPTKKEADAKLLKTITKNRNVQKINASSNDQGALKSSKAFFHKLQDTA-----AATASK 645
            .::| ||.||.:| |..||.|.|......:.....|: |||||:|||.:|||..     .|.:::
 Frog   641 TEKGKKAYTKADA-ADDLKKIAKEGKATVLKDEGKDK-ALKSSQAFFSQLQDQVKLQIKGAKSAQ 703

  Fly   646 KRPKKDTAKADAKKLKL 662
            |:.||:. :....||||
 Frog   704 KKQKKEN-ELSVHKLKL 719

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13097NP_609237.1 Mpp10 23..616 CDD:281935 242/671 (36%)
mphosph10NP_001186500.1 Mpp10 22..670 CDD:281935 242/671 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C296047763
eggNOG 1 0.900 E1_COG5384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D291875at33208
OrthoFinder 1 1.000 FOG0003266
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.