DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13088 and CG15412

DIOPT Version :10

Sequence 1:NP_609234.2 Gene:CG13088 / 34180 FlyBaseID:FBgn0032047 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001259996.1 Gene:CG15412 / 33553 FlyBaseID:FBgn0031528 Length:486 Species:Drosophila melanogaster


Alignment Length:319 Identity:69/319 - (21%)
Similarity:105/319 - (32%) Gaps:101/319 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DVWIDILKYLPMRDQLSLVEV----NENIS----AYVKYHWSH---LKTVTLTREDLDFLDRN-- 58
            ::.||:|........|::|:|    .|||.    |.:..|...   |.|.:.....|.|:..|  
  Fly   182 EIGIDLLAKGVCSQSLTVVDVGMPGEENICYSDIALILEHCPQVETLSTYSFVGASLKFIHDNVD 246

  Fly    59 ------NKLMHECLGGWSATVERLNLQSASSDLLRKWTEY-DFPHLRSLDCHMDYNLEEADEETL 116
                  .|.:|:      ...:...||.......|..|.| |.|...||......||.:......
  Fly   247 DRFKCRLKYIHD------TGTDEATLQVIMQTCPRLETLYLDSPKTGSLRALSTRNLRKLKIYKF 305

  Fly   117 LLTELFPLLTRLSLNSSTTGRYLWHWKQLRELNLTWCEYLDPDHFEEIFGNLQLTKLTMLYYGYN 181
            ::.||.|||.|      ..||.|.|...::.|                 |||:|.||..|     
  Fly   306 VVAELLPLLER------PIGRNLRHLTMIKGL-----------------GNLELGKLARL----- 342

  Fly   182 VNLGEKVVDITRCTTLEELHIDDHHLLGDFLPRLMNLPHFRRLAFYTRDYYEYLLGSVARHKPLK 246
                        |.:|.:|..                        |..|...|..|. |:.:.|:
  Fly   343 ------------CPSLIDLDC------------------------YMIDSLSYGAGH-AKFQQLE 370

  Fly   247 VQSLLFNDSFWSSERVAGSILHMTNLRRLVLQ-----EDDIDAQQLHTICHKLPNLEEL 300
            ...:|.:....||  :...:.:.|:|:||.:.     :|||.:..:.   |....||::
  Fly   371 GLEILSSAILTSS--LKAFLCNSTDLKRLAVDTVEFTDDDIMSMFMQ---HDFKVLEDV 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13088NP_609234.2 None
CG15412NP_001259996.1 AMN1 <142..>228 CDD:187754 11/45 (24%)
leucine-rich repeat 145..168 CDD:275381
leucine-rich repeat 169..196 CDD:275381 3/13 (23%)
leucine-rich repeat 197..224 CDD:275381 8/26 (31%)
leucine-rich repeat 225..252 CDD:275381 5/26 (19%)
leucine-rich repeat 253..275 CDD:275381 4/27 (15%)
leucine-rich repeat 369..393 CDD:275381 4/25 (16%)
leucine-rich repeat 394..416 CDD:275381 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.