DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: d and ck

Sequence 1:NP_001188730.1 Gene:d FlyBaseID:FBgn0262029 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001285949.1 Gene:ck FlyBaseID:FBgn0000317 Length:2167 Species:Drosophila melanogaster

Alignment Length:808 Identity:236/809 (29%)
Similarity:368/809 (45%) Gaps:149/809 (18%)


  Fly   470 SSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPY----LDVGNPLTLTSTR 530
            ||.:.::|:|.| |.|.|..::|.|..|:.|...:|..|.||:::|||    :..|:.:.|...|
  Fly    60 SSVQGVEDMISL-GDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKER 123

  Fly   531 AM-PLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGPETDAFKH 594
            .: .|.|.:..|...|..........|.|::||.||||||.:..|:|:.|.||:|        ||
  Fly   124 KIGELPPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISG--------KH 180

  Fly   595 ------LAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVT-DGALYRTKIHCYFLDQTRVIRPLP 652
                  :..|..:|.:.|:|||..|..|||.|::|::..: :|.:...||..|.|:::|::....
  Fly   181 SWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNH 245

  Fly   653 KEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLRG--DIGQNEQEDAARFQAWKTCLGILGI 715
            .|:|||:||.:|||||.:|:.:|.|.  ..|:.:||.|  .|....::|||.|...::.:.:|  
  Fly   246 SERNYHVFYCILAGLSADEKSRLDLG--MAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKVL-- 306

  Fly   716 PFLD-----VVRVLAAVLLLGNVQFIDGGGLEVDVKGETEL------NSVASLLGVPPAALFRGL 769
            .|.|     ::::|||:|..||:::   ....||....||:      ..||.|||:|...|...|
  Fly   307 LFSDQEIWEIIKLLAALLHCGNIKY---KATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDAL 368

  Fly   770 TTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTLSSDSNESV 834
            |.||....|:.|.|......:...||...|.:|.|....|||:                      
  Fly   369 TRRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRK---------------------- 411

  Fly   835 HNQADVASQHASTIGGGNAGSKSMAALNNAV--RHATSDGFIGILDMFGFEEPSPHAHLEHLCIN 897
                                      :|.|:  ...||...||:||:||||....:: .|..|||
  Fly   412 --------------------------INTAIFKPRGTSRNAIGVLDIFGFENFDQNS-FEQFCIN 449

  Fly   898 LCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISSLRTGLLSMLDAECSV-RG 961
            ...|.:|.|:..||||...|....|.|... .:::|||...:|||:..:..:::::|.|... :|
  Fly   450 YANENLQQFFVQHIFKLEQEEYNHEAINWQ-HIEFVDNQDALDLIAIKQLNIMALIDEEARFPKG 513

  Fly   962 TAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVEYDTTDFLDTNRDVVPDDLVGVF 1026
            |.::.:.||...| .|.:...||.::.:  ..|.:.||||.|.|||..|||.|||....||:.:.
  Fly   514 TDQTMLAKLHKTH-GSHKNYLKPKSDIN--TSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLV 575

  Fly  1027 YKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPTSHSDLLNGDEP---VSTLTQDFHTRLD 1088
            .:.|..|          |:.::||                 |:..|.|.   ..||:..|...||
  Fly   576 SQSTNKF----------LRQIFAQ-----------------DIEMGAETRKRTPTLSTQFRKSLD 613

  Fly  1089 NLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQIRSLQVLETVNLMASGFPHRMRFKQFNAR 1153
            .|::||...:|.|:|||:.|..:....|||....||:|...::||:.:..:|:|.|..|::|..|
  Fly   614 ALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVER 678

  Fly  1154 YRMLAP-FRLLRRSEDKALED--CQLIL---KYAMEQPPVLDGSVTLAWAPGKRHVFLSEGIRQH 1212
            ||.|.| .....|::.:|...  |.::|   .|.:                |...|||.:.....
  Fly   679 YRFLIPGVPPAHRTDCQAATSRICAVVLGKSDYQL----------------GHTKVFLKDAHDLF 727

  Fly  1213 LEHLRTEIRHKSATLMQATWRGWWWRKK 1240
            ||..|..:..:...::|.:.|||.:|::
  Fly   728 LEQERDRVLTRKILILQRSIRGWVYRRR 755

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dNP_001188730.1 MYSc 476..1217 CDD:214580 228/778 (29%)
MYSc_Myo20 488..1206 CDD:276847 220/755 (29%)
ckNP_001285949.1 MYSc 64..733 CDD:214580 229/781 (29%)
MYSc_Myo7 77..721 CDD:276832 220/755 (29%)
MyTH4 <1138..1245 CDD:214535
B41 1251..1467 CDD:214604
FERM_B-lobe 1355..1439 CDD:271216
FERM_C1_MyoVII 1461..1559 CDD:270019
SH3 1560..1624 CDD:302595
MyTH4 1701..1849 CDD:214535
B41 1856..2068 CDD:214604
FERM_M 1966..2068 CDD:278785
FERM_C2_MyoVII 2064..2159 CDD:270020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103688012
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13140
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.