DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and TAF14

DIOPT Version :9

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_015196.1 Gene:TAF14 / 855974 SGDID:S000006050 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:45/209 - (21%)
Similarity:84/209 - (40%) Gaps:46/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 KWLVYV-----QGKDLPEPLEKYIKKVRFHLHPSY-RPN-DIVDVHRSPFQLNRHGWGEFPMRIQ 334
            :|.:.:     :||::|..:   ..||.:||||:: .|| ...|   .||::...|||.||:.|.
Yeast    31 QWSIEIVLLDDEGKEIPATI---FDKVIYHLHPTFANPNRTFTD---PPFRIEEQGWGGFPLDIS 89

  Fly   335 LFFQEHLQQKPVQLMHTVVLDKTMCGLHTMG-------AETTVEIWLRAKQAITKQ--KSGKPHP 390
            :|..|...::.:.              |.:.       .|..::|.|. |..:|::  |||....
Yeast    90 VFLLEKAGERKIP--------------HDLNFLQESYEVEHVIQIPLN-KPLLTEELAKSGSTEE 139

  Fly   391 PHEQETAVPAPPLAAPNVLEPSVFAFPGESCKPRTISITQNKEELD-DNLFAGINKIELSDDIEK 454
            .......:...........||       ::.:.:|.|.:..|..:| :.|..|:.|:. .||:..
Yeast   140 TTANTGTIGKRRTTTNTTAEP-------KAKRAKTGSASTVKGSVDLEKLAFGLTKLN-EDDLVG 196

  Fly   455 IEPTVLVSEPLKLN 468
            :...|..::..::|
Yeast   197 VVQMVTDNKTPEMN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS_YEATS2_like 249..375 CDD:341126 26/111 (23%)
TAF14NP_015196.1 TFG3 2..242 CDD:227366 45/209 (22%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.