DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and Yeats4

DIOPT Version :8

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_080846.1 Gene:Yeats4 / 64050 MGIID:1927224 Length:227 Species:Mus musculus

Alignment Length:139 Identity:45/140 (32%)
Similarity:74/140 (53%) Gaps:18/140 (13%)


  Fly   252 VVGNTSKYIGEDSRENGTGGNALTYKWLVYVQGKDLP---EPLEKYIKKVRFHLHPSYRPNDIVD 313
            |.||.::|.|:...|:|.     |::|.|||:    |   |.:..|:||::|.||.|| .|.:..
Mouse    26 VYGNVARYFGKKREEDGH-----THQWTVYVK----PYRNEDMSAYVKKIQFKLHESY-GNPLRV 80

  Fly   314 VHRSPFQLNRHGWGEFPMRIQLFFQEHLQQKPVQLMHTVVL----DKTMCGLHTMGAETTVEIWL 374
            |.:.|:::...|||||.:.|::||.:. .::||.|.|.:.|    ...|.|..|:.:|...|:..
Mouse    81 VTKPPYEITETGWGEFEIIIKIFFIDP-NERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIF 144

  Fly   375 RAKQAITKQ 383
            :...|:.:|
Mouse   145 QDPTAMMQQ 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 31/89 (35%)
Yeats4NP_080846.1 YEATS_GAS41_like 19..155 CDD:341128 45/140 (32%)
Interaction with MLLT10. {ECO:0000250} 163..227
Interaction with TACC1. {ECO:0000250} 168..227
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.