Sequence 1: | NP_609228.2 | Gene: | D12 / 34172 | FlyBaseID: | FBgn0027490 | Length: | 969 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080846.1 | Gene: | Yeats4 / 64050 | MGIID: | 1927224 | Length: | 227 | Species: | Mus musculus |
Alignment Length: | 139 | Identity: | 45/140 (32%) |
---|---|---|---|
Similarity: | 74/140 (53%) | Gaps: | 18/140 (13%) |
Fly 252 VVGNTSKYIGEDSRENGTGGNALTYKWLVYVQGKDLP---EPLEKYIKKVRFHLHPSYRPNDIVD 313
Fly 314 VHRSPFQLNRHGWGEFPMRIQLFFQEHLQQKPVQLMHTVVL----DKTMCGLHTMGAETTVEIWL 374
Fly 375 RAKQAITKQ 383 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
D12 | NP_609228.2 | YEATS | 275..357 | CDD:281374 | 31/89 (35%) |
Yeats4 | NP_080846.1 | YEATS_GAS41_like | 19..155 | CDD:341128 | 45/140 (32%) |
Interaction with MLLT10. {ECO:0000250} | 163..227 | ||||
Interaction with TACC1. {ECO:0000250} | 168..227 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | E1_COG5033 | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |