DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and mllt3

DIOPT Version :8

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:XP_009301332.1 Gene:mllt3 / 550517 ZFINID:ZDB-GENE-050417-356 Length:587 Species:Danio rerio

Alignment Length:671 Identity:129/672 (19%)
Similarity:217/672 (32%) Gaps:222/672 (33%)


  Fly   275 TYKWLVYVQGKDLPE--PLEKYIKKVRFHLHPSY-RPNDIVDVHRSPFQLNRHGWGEFPMRIQLF 336
            |:.|:|:|:|   ||  .::.:::||.||||.|: ||..:  ....|:::...|:..|.:.|:::
Zfish    29 THDWMVFVRG---PEHSNIQHFVEKVVFHLHESFPRPKRV--CKDPPYKVEESGYAGFILPIEVY 88

  Fly   337 FQEHLQQKPVQLMHTVVL--------DKTMCGLHTMGAETTVEIWLRAKQAITKQKSGKPHPPH- 392
            |:...:.|.|:..:.:.|        :...|...|....|..   .|.|..    |:|....|| 
Zfish    89 FKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEE---FRRKLL----KAGGQRDPHK 146

  Fly   393 ------------EQETAVPAPPLAAPNVLEPSVF----------AFPG--ESCKPRTISITQNKE 433
                        |..|::..|.|..|.:...|:.          :|||  :..|..:...|.|. 
Zfish   147 RSSEDSKVMVMQEGSTSLFGPHLKLPTLPSSSLTLTFSDAKKSKSFPGSKDGSKSSSALTTTNN- 210

  Fly   434 ELDDNLFAGINKIELSDDIEKIEPTVLVSEPLKLNYSPRKQPPTPSSPPRTQLRLNAAQVTASKP 498
                                      :.|..|||:..|:........|.:......:|....||.
Zfish   211 --------------------------ISSSSLKLHKPPKDHKDHKDKPSKDSKESKSAFRDFSKD 249

  Fly   499 SVVYLPVNGRSPRQESLPERQR--QEFSPVKHYPPASPQRAWKE-----------SSSDRPPIKP 550
            |       |:..:....|:..:  ||..|:.......|:.|.||           |.|.|.|:  
Zfish   250 S-------GKLSKDSKKPKENQPIQEDRPIPQMGFKEPKSASKEQRSSELSFSSLSQSKRRPV-- 305

  Fly   551 VPN-GHHQGKKNVVFQRAGKLYIIDPLQRKLKQAAKQQ---SLLKPQ-----LSLLKPPSETRWH 606
            :.| ||...|:...|..:.:               |||   :||:.|     ..:||...:.|.:
Zfish   306 LDNEGHVTKKRKSSFSESSQ---------------KQQACPALLQQQHHHSDKKVLKDKPQIRHN 355

  Fly   607 MLQCMQHDHGYANMSGEMEEKPML--LPPIVDTTIQSRPRRLEHIFRSAQFRNMRSAVEFLLSRL 669
            .||           :.|:.||..|  |||                     |:|:....:      
Zfish   356 RLQ-----------NSELSEKKKLQALPP---------------------FQNVLDPND------ 382

  Fly   670 PLASIDQQKEYPFTCITLEEFHNHTALKQRCFEYLRARMLRRCLMQHHELHKLDISGKEHYWSLR 734
                 ....:..||....::....::.......:.|.             ||..:.|        
Zfish   383 -----SDMDDNTFTRSDSDQPSPASSSSSSSSGFGRG-------------HKRQVLG-------- 421

  Fly   735 EIVAFARVHGYTPALKDVLPVVHEKRKQKLSDEE-------QLARRVQAQLKGEPQPQLSAYSSL 792
                         .|:.|:|.:|....::.|:|:       .|.|.|..|:....:     ..||
Zfish   422 -------------PLRSVIPDLHSDENEEDSEEDDDNDMDSDLERPVHTQMTHRHR-----RVSL 468

  Fly   793 SSGNRLEAWITKQSDRLLGHDQQ----MRDKEFIDVLGVDKPHPLASRLTNSADVSF--QMVN-H 850
            |.|:..|   .......|.|:..    ......|:|.|..|...:........|.::  ::|. |
Zfish   469 SDGSESE---NSSGSSPLPHNDPPPLLKNSSNQIEVKGPIKQAKMDKNKNIDCDKAYLDELVELH 530

  Fly   851 RQLLYLPPPKHLDSTLQLVQE 871
            |:|:.|.....|...:.|::|
Zfish   531 RRLMALRERHILQQIVNLIEE 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 24/93 (26%)
mllt3XP_009301332.1 YEATS 29..109 CDD:281374 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.