DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and mllt3

DIOPT Version :8

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:XP_012818507.1 Gene:mllt3 / 549668 XenbaseID:XB-GENE-6257679 Length:578 Species:Xenopus tropicalis

Alignment Length:394 Identity:86/395 (22%)
Similarity:151/395 (38%) Gaps:90/395 (23%)


  Fly   275 TYKWLVYVQGKDLPE--PLEKYIKKVRFHLHPSY-RPNDIVDVHRSPFQLNRHGWGEFPMRIQLF 336
            |:.|:|:|:|   ||  .::.:::||.||||.|: ||..:  ....|:::...|:..|.:.|:::
 Frog    26 THDWMVFVRG---PEHSNIQHFVEKVVFHLHESFPRPKRV--CKDPPYKVEESGYAGFILPIEVY 85

  Fly   337 FQEHLQQKPVQLMHTVVLDKTMCGLHTMGAETTVEIWLRAKQAITKQKSGKPHPPHE----QETA 397
            |:...:.|.|:..:.:.       ||..|                       |||..    ::..
 Frog    86 FKNKEEPKKVRFDYDLF-------LHLEG-----------------------HPPVNHLRCEKLT 120

  Fly   398 VPAPP-------LAAPNVL---EPSVFA------FPGESCKPRTIS-ITQNKE---ELDDNLFAG 442
            ...|.       |.|..::   |.|.|:      .|...|...:.| :.::|.   ..|.|....
 Frog   121 FNNPTEEFRRKLLKAGGIMVTSEGSSFSSGTSLHLPSLPCNSLSFSDVKKSKSSHGSKDPNKLVS 185

  Fly   443 INKIELSDDIEKIEPTVLVSEPLKLNYSPRKQPPTPSSPPRTQLRLNAAQVTASKPSVVYLPVNG 507
            ||....|         :.:|:|.|.:...:::....|...|:..:         :||    ..:.
 Frog   186 INNSSNS---------ISLSKPHKSSKEHKEKSSKYSKEHRSAFK---------EPS----REHN 228

  Fly   508 RSPRQESLPERQRQEFSPVKHYPPAS---PQRAWKESSSDRPPIKPVPNGHHQGKKNVVFQRAGK 569
            :|.::.|...::.:.....|..|..:   |:...||...:...|..|..||.|.|| :..:|...
 Frog   229 KSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPRCENNNILTVSTGHQQEKK-LSSKRPPH 292

  Fly   570 LYIIDPLQRKLKQAAKQQSLLK-PQLSLLKPPSETRWHMLQCMQHDHGYANMSGE-MEEKPMLLP 632
            |...||..||.|::..:.|:.. ...|||...|..:..:.....|..|...:..| |::|.:.||
 Frog   293 LDSEDPFARKRKKSNSESSVKSFSNSSLLILSSSDKKPLRDKSVHKIGKVKIESEVMDKKKLSLP 357

  Fly   633 PIVD 636
            |..|
 Frog   358 PFED 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 23/85 (27%)
mllt3XP_012818507.1 YEATS 26..106 CDD:281374 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.