DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and mllt3

DIOPT Version :9

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:XP_012818507.1 Gene:mllt3 / 549668 XenbaseID:XB-GENE-6257679 Length:578 Species:Xenopus tropicalis


Alignment Length:394 Identity:86/394 - (21%)
Similarity:151/394 - (38%) Gaps:90/394 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 TYKWLVYVQGKDLPE--PLEKYIKKVRFHLHPSY-RPNDIVDVHRSPFQLNRHGWGEFPMRIQLF 336
            |:.|:|:|:|   ||  .::.:::||.||||.|: ||..:  ....|:::...|:..|.:.|:::
 Frog    26 THDWMVFVRG---PEHSNIQHFVEKVVFHLHESFPRPKRV--CKDPPYKVEESGYAGFILPIEVY 85

  Fly   337 FQEHLQQKPVQLMHTVVLDKTMCGLHTMGAETTVEIWLRAKQAITKQKSGKPHPPHE----QETA 397
            |:...:.|.|:..:.:.       ||..|                       |||..    ::..
 Frog    86 FKNKEEPKKVRFDYDLF-------LHLEG-----------------------HPPVNHLRCEKLT 120

  Fly   398 VPAPP-------LAAPNVL---EPSVFA------FPGESCKPRTIS-ITQNKE---ELDDNLFAG 442
            ...|.       |.|..::   |.|.|:      .|...|...:.| :.::|.   ..|.|....
 Frog   121 FNNPTEEFRRKLLKAGGIMVTSEGSSFSSGTSLHLPSLPCNSLSFSDVKKSKSSHGSKDPNKLVS 185

  Fly   443 INKIELSDDIEKIEPTVLVSEPLKLNYSPRKQPPTPSSPPRTQLRLNAAQVTASKPSVVYLPVNG 507
            ||....|         :.:|:|.|.:...:::....|...|:..:         :||    ..:.
 Frog   186 INNSSNS---------ISLSKPHKSSKEHKEKSSKYSKEHRSAFK---------EPS----REHN 228

  Fly   508 RSPRQESLPERQRQEFSPVKHYPPAS---PQRAWKESSSDRPPIKPVPNGHHQGKKNVVFQRAGK 569
            :|.::.|...::.:.....|..|..:   |:...||...:...|..|..||.|.|| :..:|...
 Frog   229 KSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPRCENNNILTVSTGHQQEKK-LSSKRPPH 292

  Fly   570 LYIIDPLQRKLKQAAKQQSLLK-PQLSLLKPPSETRWHMLQCMQHDHGYANMSGE-MEEKPMLLP 632
            |...||..||.|::..:.|:.. ...|||...|..:..:.....|..|...:..| |::|.:.||
 Frog   293 LDSEDPFARKRKKSNSESSVKSFSNSSLLILSSSDKKPLRDKSVHKIGKVKIESEVMDKKKLSLP 357

  Fly   633 PIVD 636
            |..|
 Frog   358 PFED 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS_YEATS2_like 249..375 CDD:341126 26/102 (25%)
mllt3XP_012818507.1 YEATS_AF-9_like 6..134 CDD:341125 30/142 (21%)
AHD 513..573 CDD:436050
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.