DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and MLLT3

DIOPT Version :8

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_004520.2 Gene:MLLT3 / 4300 HGNCID:7136 Length:568 Species:Homo sapiens

Alignment Length:690 Identity:122/691 (18%)
Similarity:228/691 (33%) Gaps:230/691 (33%)


  Fly   275 TYKWLVYVQGKDLPE--PLEKYIKKVRFHLHPSY-RPNDIVDVHRSPFQLNRHGWGEFPMRIQLF 336
            |:.|:|:|:|   ||  .::.:::||.||||.|: ||..:  ....|:::...|:..|.:.|:::
Human    29 THDWMVFVRG---PEHSNIQHFVEKVVFHLHESFPRPKRV--CKDPPYKVEESGYAGFILPIEVY 88

  Fly   337 FQEHLQQKPVQLMHTVVLDKTMCGLHTMGAETTVEIWLRAKQAITKQKSGKPHPP--HEQETAVP 399
            |:...:.:.|:..:.:.       ||..|                       |||  |.:     
Human    89 FKNKEEPRKVRFDYDLF-------LHLEG-----------------------HPPVNHLR----- 118

  Fly   400 APPLAAPNVLEPSVFAFPGESCKPRTISITQNKEELDDNLFAGINKIELSDDIEKIEPTVLVSEP 464
                     .|...|..|.|..:.:.:.             ||      .|....|..:...|..
Human   119 ---------CEKLTFNNPTEDFRRKLLK-------------AG------GDPNRSIHTSSSSSSS 155

  Fly   465 LKLNYSPRKQPPTPSSPPRTQLRLNAAQVTASKPSVVYLPVNGRSPRQESLPERQRQEFSPVKHY 529
            ...:.|......:.||...:....:::..::|..|..:...:......:..|.:..:|.......
Human   156 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKE 220

  Fly   530 PPASPQRAWKESSSDRPPIKPVPNGHHQGKKNVVFQRAGKLYIIDPLQRKLKQAAKQQSLLKPQL 594
            |.....::.||||......||:.      ::.:|.:.|.|    :|     |..:|:.   ||..
Human   221 PSRDHNKSSKESSKKPKENKPLK------EEKIVPKMAFK----EP-----KPMSKEP---KPDS 267

  Fly   595 SLLKPPSETRWHMLQCMQHDHGYANMSGEMEEKPMLLPPIVDTTIQSRPRRLEHIFRSAQFRNMR 659
            :||                    ...||:.::.|...|||.|:...|..:| :.....|.|::..
Human   268 NLL--------------------TITSGQDKKAPSKRPPISDSEELSAKKR-KKSSSEALFKSFS 311

  Fly   660 SAVEFLLSRLPLASIDQQKEYPFTCITLEEFHNHTALKQRCFEYLRARMLRRCLMQHHELHKLDI 724
            ||...:|:    .|.|:::                 :|.:               .|.::.|:.|
Human   312 SAPPLILT----CSADKKQ-----------------IKDK---------------SHVKMGKVKI 340

  Fly   725 SGKEHYWSLREIVAFARVHGYTPALKDVLPVVHEKRKQKL-----------SD-EEQLARRVQAQ 777
            ..:                            ..||:|..|           || ||.::.:..::
Human   341 ESE----------------------------TSEKKKSTLPPFDDIVDPNDSDVEENISSKSDSE 377

  Fly   778 LKGEPQPQLSAYSSLSSGNRLEAWITKQ-------------------SDRLLGHDQQMRDKEFID 823
               :|.|..|:.||.||....:   |:|                   ||.:..:|.....:..::
Human   378 ---QPSPASSSSSSSSSFTPSQ---TRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVN 436

  Fly   824 VLGVDKPHPLASRLTNSADVSFQMVNHRQLLYLPPPKHLDSTLQLVQEMCKDINITLEPEESPPG 888
            ..|........|..::|...|.....|.:    |||..|.:....:.|:           :||..
Human   437 RGGSRSRRVSLSDGSDSESSSASSPLHHE----PPPPLLKTNNNQILEV-----------KSPIK 486

  Fly   889 VSQPLALSMLGQVLRTFIEKLV--RRSLAAKLQQETLEQL 926
            .|:.......|:..:.::::||  .|.|....::..|:|:
Human   487 QSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQI 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 22/85 (26%)
MLLT3NP_004520.2 YEATS 29..109 CDD:308783 24/92 (26%)
Histone H3K9cr binding. {ECO:0000244|PDB:5HJB, ECO:0000244|PDB:5HJD, ECO:0000269|PubMed:27105114} 78..80 0/2 (0%)
Histone H3K9cr binding. {ECO:0000244|PDB:5HJB, ECO:0000244|PDB:5HJD, ECO:0000269|PubMed:27105114} 106..108 2/2 (100%)
Nuclear localization signal. {ECO:0000255} 295..300 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.