DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and CRM1

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_011734.3 Gene:CRM1 SGDID:S000003450 Length:1084 Species:Saccharomyces cerevisiae

Alignment Length:1082 Identity:463/1083 (43%)
Similarity:690/1083 (64%) Gaps:37/1083 (3%)


  Fly    13 LLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYAL 77
            :||||..|||.|||::|...|...|.|.:.||.|||..:::|:||.:.|.||::|.|.::||.||
Yeast     4 ILDFSNDLDIALLDQVVSTFYQGSGVQQKQAQEILTKFQDNPDAWQKADQILQFSTNPQSKFIAL 68

  Fly    78 QILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILVHILKREWPRN 142
            .||:::|..:||:||.:...||:.:||.:||....|..|.:..|..:||.::.||.|||:|||:|
Yeast    69 SILDKLITRKWKLLPNDHRIGIRNFVVGMIISMCQDDEVFKTQKNLINKSDLTLVQILKQEWPQN 133

  Fly   143 WETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTLCS 207
            |..||.:::|:|.::.::|.|||::||.|||||||||..|:||.||.|||::|..||.|||.||.
Yeast   134 WPEFIPELIGSSSSSVNVCENNMIVLKLLSEEVFDFSAEQMTQAKALHLKNSMSKEFEQIFKLCF 198

  Fly   208 FVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNVTLKCLSEIAGLT 272
            .|||...:::||..|||:|||:|:|||..||:||..:|.|..||::.|..|.:|||||:|::.|.
Yeast   199 QVLEQGSSSSLIVATLESLLRYLHWIPYRYIYETNILELLSTKFMTSPDTRAITLKCLTEVSNLK 263

  Fly   273 AANYDE----NFATLFKDTMVQL-EQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFLKEHGK 332
            ....::    .....|::|:.|: ..::....::...:.:.:..:|..:.:|||||.|:|..:..
Yeast   264 IPQDNDLIKRQTVLFFQNTLQQIATSVMPVTADLKATYANANGNDQSFLQDLAMFLTTYLARNRA 328

  Fly   333 LVE-DAKYVDYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNSEFFHPTLESTKRQQV-- 394
            |:| |....:.|..|..||:.:|::|:.|:||..|:||::||.||:......|..|.:...|:  
Yeast   329 LLESDESLRELLLNAHQYLIQLSKIEERELFKTTLDYWHNLVADLFYEVQRLPATEMSPLIQLSV 393

  Fly   395 -------------------YP-RRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKD 439
                               :| ::..|..|.|::|.::|..|.:|||||||||:.||:||||:|:
Yeast   394 GSQAISTGSGALNPEYMKRFPLKKHIYEEICSQLRLVIIENMVRPEEVLVVENDEGEIVREFVKE 458

  Fly   440 TNSINLYKNMRETLVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEED 504
            :::|.|||:.||.||:||||:.:||:.||..||..|::|||:||.|:|||.||||||||...|:.
Yeast   459 SDTIQLYKSEREVLVYLTHLNVIDTEEIMISKLARQIDGSEWSWHNINTLSWAIGSISGTMSEDT 523

  Fly   505 EKRFLVTVIKDLLGLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETH 569
            ||||:||||||||.|..:|:||||||::||:||||||||||||:|||.||:||:.||||||||||
Yeast   524 EKRFVVTVIKDLLDLTVKKRGKDNKAVVASDIMYVVGQYPRFLKAHWNFLRTVILKLFEFMHETH 588

  Fly   570 DGVQDMACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMIS 634
            :|||||||||||||..||:.:||..||.|:..||..|:..:.....|||||||||||:|.|.:||
Yeast   589 EGVQDMACDTFIKIVQKCKYHFVIQQPRESEPFIQTIIRDIQKTTADLQPQQVHTFYKACGIIIS 653

  Fly   635 AQVDQVQQDVLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYV 699
            .:....:::.|:...|||||..||.|:.:::.|...|.:...||.:.:|:|||||.|.::|..:.
Yeast   654 EERSVAERNRLLSDLMQLPNMAWDTIVEQSTANPTLLLDSETVKIIANIIKTNVAVCTSMGADFY 718

  Fly   700 IQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLV 764
            .|||.||.:||.:|:..|..|...:...|:.....|.::.:..:|||.|.|:..::|::.:...|
Yeast   719 PQLGHIYYNMLQLYRAVSSMISAQVAAEGLIATKTPKVRGLRTIKKEILKLVETYISKARNLDDV 783

  Fly   765 MDNFIPPLLDAILLDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINK 829
            :...:.|||:|:|.||.. .||.||:.:||:.|..:|.|:...|...|..|..:|||||||||||
Yeast   784 VKVLVEPLLNAVLEDYMN-NVPDARDAEVLNCMTTVVEKVGHMIPQGVILILQSVFECTLDMINK 847

  Fly   830 NFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKML 894
            :|.::|:||:.||:||:.:|...|.|||.:|||.|||..|::.|||||..|:|...||.|...::
Yeast   848 DFTEYPEHRVEFYKLLKVINEKSFAAFLELPPAAFKLFVDAICWAFKHNNRDVEVNGLQIALDLV 912

  Fly   895 QNLDQHPGA--AQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNL-- 955
            :|:::....  |..|::.||...:.:.|.|:||:.|.:|....|::|..:.|||.:.||:|.|  
Yeast   913 KNIERMGNVPFANEFHKNYFFIFVSETFFVLTDSDHKSGFSKQALLLMKLISLVYDNKISVPLYQ 977

  Fly   956 -GPIP---DNMIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREA 1016
             ..:|   .|.:::.:|:|::|.:||.||:..|:..|::.|....:::..||..|||||:||:|.
Yeast   978 EAEVPQGTSNQVYLSQYLANMLSNAFPHLTSEQIASFLSALTKQYKDLVVFKGTLRDFLVQIKEV 1042

  Fly  1017 TGEDDSDLYLEEREAALAEEQSNKHQMQRNIPGMLNPHELPE 1058
            .|:....|:.|::|.||.|:...:.:....|.|:|.|.||.:
Yeast  1043 GGDPTDYLFAEDKENALMEQNRLEREKAAKIGGLLKPSELDD 1084

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 451/1046 (43%)
IBN_N 43..109 CDD:197981 30/66 (45%)
Xpo1 120..265 CDD:285575 77/145 (53%)
CRM1_C 701..1015 CDD:285920 120/322 (37%)
CRM1NP_011734.3 CRM1 1..1070 CDD:227432 457/1067 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25697671
eggNOG 1 0.900 E1_COG5101
Hieranoid 1 1.000
Homologene 1 1.000 H2554
Inparanoid 1 1.050 890 1.000 Inparanoid score I44
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002975
OrthoInspector 1 1.000 T1136113
orthoMCL 1 0.900 OOG5_127698
Panther 1 1.100 LDO PTHR11223
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R13754
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.