DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and MSN5

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_010622.1 Gene:MSN5 SGDID:S000002743 Length:1224 Species:Saccharomyces cerevisiae

Alignment Length:1320 Identity:228/1321 (17%)
Similarity:439/1321 (33%) Gaps:434/1321 (33%)


  Fly    29 VEVVYT--AQGEQLRLAQSILTTLKEHPEA--WTRVDSILEYSQNQRTKFYALQILEEVIKTRWK 89
            ::|:|:  :...|.:.||..|..:|...|:  | ..:..|:...|...|::.|.:|:..:|..|.
Yeast    13 LDVIYSPKSNNSQRQEAQKFLDEVKLCSESPFW-GYEIALQNPTNSILKYFGLGLLDHAVKKNWN 76

  Fly    90 VLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYL-NKLNMILVHILKREWPR------------ 141
            .....:...::|:|:.|...      |.:.:..|: .||..:.|.:.||.|..            
Yeast    77 DYDEGKRVALRKWVMELNFG------VQDYDTRYIKEKLATLWVEVAKRTWGEALKQTNPTEEQL 135

  Fly   142 --NWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTM--CSEFSQI 202
              :|....:::......|:|.....::|.:.|.|:||              |.|.:  ....:.|
Yeast   136 LTSWVDMDNNLFELWNINQSSRELALIIFRILFEDVF--------------LLDDLIVLKRMTVI 186

  Fly   203 FTLCSFV----------------------------------LENSM---NAALIHVTLETLLRFL 230
            ..||..:                                  |.|::   |:..|...||||...|
Yeast   187 QPLCVMIVCPIEVFAIKYKFSDKWTKFKANEEGWFSVWIPELNNALQQNNSEYIIRLLETLKTCL 251

  Fly   231 NWIPLGYIFETQQIETLIFKFLS--VPMFRNVTLKCLSEIAGLTAAN------------------ 275
            || ||..:.....:.:.:...||  :|..:::.|..:..:.....:|                  
Yeast   252 NW-PLTEVIVRNDVLSSLLTCLSSNIPRAQSMALDSIHILLTRPYSNESHYQMTIDRVFDNMDLL 315

  Fly   276 --------YD-------------ENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQE---LV 316
                    :|             :.|..:.....|.:.:|...|..:...||....|...   :|
Yeast   316 DSVYESLLFDPTDDIDETKYPIIKKFVDMISCLYVCVPKIKETNGQIQKYFKLVLKTTYNPSLIV 380

  Fly   317 LNLAMFL-CTFLKEHGKLVEDAKYV-----DYLNQALMYLVMI---------------------- 353
            ..|.:.| ||.|:....|.:..|||     .:...||:|...|                      
Yeast   381 SGLTLDLWCTCLRNDEYLPKLEKYVIPDLLQFAADALVYYEQIDGHISKKFAEIDFQSKSEFQTF 445

  Fly   354 -----SEVEDVEVFKICLEY-----W-NSLVEDLYNSEFFHPTLEST------------------ 389
                 ..:.|:.....|:|.     | |:.:.:.::|.|....|.||                  
Yeast   446 CSTYRKRIRDIIRLISCVELDLTYDWLNNRLNNYFSSPFGQQVLSSTFLDHKLEPYLGALSQYMI 510

  Fly   390 --------KRQQV-YPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVRE---FMKDTNS 442
                    .|.:: ||....|...|..:    :.::......|:..|     :||   ..|...:
Yeast   511 VECFINGCIRWKIWYPTGDDYDEKLDSI----LQKLEILSNQLIALN-----LREPLLLKKQIQN 566

  Fly   443 INLYKNMRETLVFLTHLDSVDTDRIMTLKLLN-QVNGSEF-SWKNLNTLCWAIGSISGAFCEEDE 505
            ..|:..|.:..|..|.|:.:.|...|....:| :..|:|. :.::|...|....:.......|..
Yeast   567 FALFLTMLKDNVLFTLLEKIITSATMDYPEINLEERGAESDAVRDLRYACGIELNRMALLMPESL 631

  Fly   506 KR---------------------------FLVTVIKDLLGLCEQKKGK--DNKAIIASNIMYVVG 541
            |:                           .|:.|:|..|.:.|::...  |.:.:..|:...|||
Yeast   632 KKIYPDLESVIARIMPNLSYHEKISFKSFLLIIVLKSSLDMKEERFAAIVDPELLAWSDKTTVVG 696

  Fly   542 QYPRFLRAHWKFLKTVVNKLFEF-----MHETHD----GVQDMACDTFIKIA--------IKCRR 589
                ....||...:..:.::.|:     :.|..|    .:.|...:...::.        ::..|
Yeast   697 ----LSDLHWFMERLGIVQIAEYFQRRDIDENSDLLSIPIDDEGKELKSELTKRWQSLFPVRATR 757

  Fly   590 YFV-----TIQPNEACTFIDE--------ILTTMSSIICDLQ-----------PQQVHTF--YEA 628
            .|:     :|:.:|....:.:        ||..::.::..||           |..|.:|  |..
Yeast   758 MFIHYSMQSIKTDEEFKMLQDLWRPRIVPILPYITRLLYQLQSYHDPDNWKGLPTVVQSFVKYST 822

  Fly   629 VGYMISAQVDQVQQDVLIERYMQLPNQVWD-----DIISRASKNVDFLKNMTAVKQLGSILKTNV 688
            :.....|......:|..|:.:|:....:.|     ..|.|.::....|. ::|:..|||:.    
Yeast   823 IERFWEAGASNKSKDEFIDEHMKAMQTLRDFADSVGHIIRYTREYTLLV-LSAISSLGSVF---- 882

  Fly   689 AACKALGHAYVI-QLGRIYLDMLNVYKITSENIIQAIEVNG----VNVNNQPLIKTMHVVKKETL 748
                     |:: :...:.|:.:.::|..|..|...:..:|    :|:..:|::|.   ..|:.|
Yeast   883 ---------YLLDESPDLLLNSIAIFKPGSNEISPGVSTHGWKHIMNIAIRPILKG---CPKDCL 935

  Fly   749 NLISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCK-------------VPSAREPKVLSAMAII 800
            ...             |..|:|.|.:  :||...|:             ||:..:.   ....|:
Yeast   936 GKF-------------MPAFLPKLFE--ILDLLLCQKWSSHMNDMDMNPVPTDDDQ---MTEEIL 982

  Fly   801 VHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFK 865
            ...|.:.:|..|.:|   |.:| :...|.| .:..:.||:.:::                     
Yeast   983 EENLLRQLTTVVVRI---VIDC-VGQGNAN-PNSAKSRLNNHQM--------------------- 1021

  Fly   866 LVFDSVVWAFKHTMRNVADMGLNIL---FKMLQNLDQHPGAAQSFYQT--YFTDILMQ---IFSV 922
                        .||.:....||.|   .|:|.:|       .||..|  .|..||:.   :.||
Yeast  1022 ------------EMRKIIFNDLNTLAPFLKLLNHL-------ISFKDTKCSFNSILVMKCCLTSV 1067

  Fly   923 VTDTSHTAGLPNHAIILAYMFSLVENRKITVNLGPIPDNMIFIQEYVASLLKSAFTHLSDNQVKV 987
            :..        |:.:...:.|.:::|..:.|..     |..|...:..:|.  |||.:.....|.
Yeast  1068 LNQ--------NNTVDEYFTFEVMKNLLLNVLC-----NSAFKDSFHEALY--AFTVIFLTLCKE 1117

  Fly   988 F---------VTGLFNLDE---NVQAFKEH------LRDFLIQIREATGEDDSDL--------YL 1026
            :         ::..:|:||   |:::..|:      :.||:..::..:|::|.::        ..
Yeast  1118 YPSARAFLFEISNGYNIDELYRNLRSVDEYKTQRALMIDFIDWVKSTSGKEDGNVDHAGDERKRQ 1182

  Fly  1027 EEREAALAEEQSNKHQMQRN 1046
            |:|||.|  :::|:..:::|
Yeast  1183 EKREAIL--KKANERLIKKN 1200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 221/1288 (17%)
IBN_N 43..109 CDD:197981 16/68 (24%)
Xpo1 120..265 CDD:285575 37/201 (18%)
CRM1_C 701..1015 CDD:285920 64/357 (18%)
MSN5NP_010622.1 IBN_N 29..93 CDD:197981 15/65 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.