DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and XPO1A

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_197204.1 Gene:XPO1A AraportID:AT5G17020 Length:1075 Species:Arabidopsis thaliana

Alignment Length:1079 Identity:497/1080 (46%)
Similarity:711/1080 (66%) Gaps:33/1080 (3%)


  Fly    10 AGKLLDFSQKLDINLLDKIVEVVY-TAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTK 73
            |.||.|.||.:|:.:||..|...: |...|:...|..||..|:.:|:.|.:|..||:.:.:..||
plant     3 AEKLRDLSQPIDVGVLDATVAAFFVTGSKEERAAADQILRDLQANPDMWLQVVHILQNTNSLDTK 67

  Fly    74 FYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILVHILKRE 138
            |:|||:||.|||.||..||..|.:|:|.|:..:|::.||:.......::|:||||:|||.|:|.:
plant    68 FFALQVLEGVIKYRWNALPVEQRDGMKNYISEVIVQLSSNEASFRSERLYVNKLNVILVQIVKHD 132

  Fly   139 WPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIF 203
            ||..|.:||.|:|.|:||:|::|.|.|.|||.|||||||||:|::||.|.|.||.::.|||..|.
plant   133 WPAKWTSFIPDLVAAAKTSETICENCMAILKLLSEEVFDFSRGEMTQQKIKELKQSLNSEFKLIH 197

  Fly   204 TLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNVTLKCLSEI 268
            .||.:||..|....||..||..|..:|:|||||||||:..:|||: ||..||.:||:|::||:|:
plant   198 ELCLYVLSASQRQDLIRATLSALHAYLSWIPLGYIFESTLLETLL-KFFPVPAYRNLTIQCLTEV 261

  Fly   269 AGLTAAN-YDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFLKEHGK 332
            |.|...: |:..:..::...:.||..|:..:..:...:..||..||..:.|||:|..:|.|.|.:
plant   262 AALNFGDFYNVQYVKMYTIFIGQLRIILPPSTKIPEAYSSGSGEEQAFIQNLALFFTSFFKFHIR 326

  Fly   333 LVEDA-KYVDYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNSEF--------------- 381
            ::|.. :.|..|...|.||:.||.|:|.||||:||:||||||.:|:::..               
plant   327 VLESTPEVVSLLLAGLEYLINISYVDDTEVFKVCLDYWNSLVLELFDAHHNSDNPAVSASLMGLQ 391

  Fly   382 -FHPTLESTKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINL 445
             |.|.:......||..||:.|:..:||:|.:||:|||||||||:||:|||.:|||.|||.:.:..
plant   392 PFLPGMVDGLGSQVMQRRQLYSHPMSKLRGLMINRMAKPEEVLIVEDENGNIVRETMKDNDVLVQ 456

  Fly   446 YKNMRETLVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLV 510
            ||.|||||::|:|||..||::.|..||..|::|.|::|.||||||||||||||:..|:.|.||||
plant   457 YKIMRETLIYLSHLDHDDTEKQMLRKLNKQLSGEEWAWNNLNTLCWAIGSISGSMAEDQENRFLV 521

  Fly   511 TVIKDLLGLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDM 575
            .||:|||.|||..|||||||:||||||||||||||||||||||||||||||||||||||.|||||
plant   522 MVIRDLLNLCEITKGKDNKAVIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHPGVQDM 586

  Fly   576 ACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQV 640
            |||||:||..||:|.||.:|..|...|:.|:||.:::.:.||:|.|:|:|||:||.||.|:.|..
plant   587 ACDTFLKIVQKCKRKFVIVQVGENEPFVSELLTGLATTVQDLEPHQIHSFYESVGNMIQAESDPQ 651

  Fly   641 QQDVLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRI 705
            ::|..::|.|.||||.|.:||.:|..:|:|||:...::.:.:||:||.:|..:||..::.|:..|
plant   652 KRDEYLQRLMALPNQKWAEIIGQARHSVEFLKDQVVIRTVLNILQTNTSAATSLGTYFLSQISLI 716

  Fly   706 YLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIP 770
            :|||||||::.||.:...|...|...:....:|.:..||:|||.||..::.::.|...:...|:|
plant   717 FLDMLNVYRMYSELVSTNITEGGPYASKTSFVKLLRSVKRETLKLIETFLDKAEDQPHIGKQFVP 781

  Fly   771 PLLDAILLDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFP 835
            |:::::|.||.| .||.|||.:|||..|.|::|.:..:.::||.||:|||:|||:||.|||||:|
plant   782 PMMESVLGDYAR-NVPDARESEVLSLFATIINKYKATMLDDVPHIFEAVFQCTLEMITKNFEDYP 845

  Fly   836 QHRLSFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLDQH 900
            :|||.|:.||:|:...||.|.:.:...|.|||.||::|||:||.||:|:.|||:|.:||:|..|.
plant   846 EHRLKFFSLLRAIATFCFPALIKLSSPQLKLVMDSIIWAFRHTERNIAETGLNLLLEMLKNFQQS 910

  Fly   901 PGAAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNLG-------PI 958
            ....| ||::||..|..:||:|:|||.|..|...|.::|..:|.|.|:..:|..|.       |.
plant   911 EFCNQ-FYRSYFMQIEQEIFAVLTDTFHKPGFKLHVLVLQQLFCLPESGALTEPLWDATTVPYPY 974

  Fly   959 PDNMIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSD 1023
            |||:.|::||...||.|:|.:::..:|..||.||:....:...||.::||||:|.:|.:.:|:.|
plant   975 PDNVAFVREYTIKLLSSSFPNMTAAEVTQFVNGLYESRNDPSGFKNNIRDFLVQSKEFSAQDNKD 1039

  Fly  1024 LYLEEREAALAEEQSNKHQMQRNIPGMLNPHELPEDMQD 1062
            ||.||    .|.::..:.|...:|||::.|:|:.::|.|
plant  1040 LYAEE----AAAQRERERQRMLSIPGLIAPNEIQDEMVD 1074

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 481/1036 (46%)
IBN_N 43..109 CDD:197981 29/66 (44%)
Xpo1 120..265 CDD:285575 78/145 (54%)
CRM1_C 701..1015 CDD:285920 134/321 (42%)
XPO1ANP_197204.1 CRM1 4..1044 CDD:227432 486/1043 (47%)
IBN_N 37..103 CDD:281761 29/66 (44%)
Xpo1 114..258 CDD:285575 78/145 (54%)
CRM1_C 712..1033 CDD:285920 135/323 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2554
Inparanoid 1 1.050 962 1.000 Inparanoid score I47
OMA 1 1.010
OrthoDB 1 1.010 D132850at2759
OrthoInspector 1 1.000 T124847
orthoMCL 1 0.900 OOG5_127698
Panther 1 1.100 LDO PTHR11223
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.