DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and Xpo6

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_017167830.1 Gene:Xpo6 MGIID:2429950 Length:1140 Species:Mus musculus

Alignment Length:1324 Identity:246/1325 (19%)
Similarity:435/1325 (33%) Gaps:481/1325 (36%)


  Fly    17 SQKLDINLLDKIVEVVY--TAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYALQI 79
            |::..:..|:.::...:  ....|:.|..:.:|....:...||......|..::|.....|:|.:
Mouse     3 SEEASLRALESLMTEFFHDCTTNERKREIEELLNNFAQQVGAWRFCLYFLSSTRNDYVMMYSLTV 67

  Fly    80 LEEVIKTRWKVLPRNQCEGIKKYVVSLII---KTSSDPIVMEQNKVYLNKLNMILVHILKREWPR 141
            .|.:|...|..:|......|:..:..|::   ||.  |..:.      |||..::|.|.:::||.
Mouse    68 FENLINKMWLGVPSQDKMEIRSCLPKLLLAHHKTL--PYFIR------NKLCKVIVDIGRQDWPM 124

  Fly   142 NWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTLC 206
            .:..|.::|:...::..:..: .:::||..|||: ...:..::..:.:.|:..:..:...:..|.
Mouse   125 FYHDFFTNILQLIQSPVTTPL-GLIMLKTTSEEL-ACPREDLSVARKEELRKLLLDQVQTVLGLL 187

  Fly   207 SFVLE-----NSMNAA--------------------------LIH---------------VTLET 225
            :.:||     :|:.||                          |:|               :.||.
Mouse   188 TGILETVWDKHSVTAATPPPSPTSGESGDLLSNLLQSPSSAKLLHQPIPILDVESEYVCSLALEC 252

  Fly   226 LLRFLNWIPLGYIFETQQIETLIFKF------------------------------LSVPMFRNV 260
            |....:||||.... |..:.|.||.|                              |.|     :
Mouse   253 LAHLFSWIPLSASI-TPSLLTTIFHFARFGCDTRARKMASVNGSSQNCVLGQERGRLGV-----L 311

  Fly   261 TLKCLSEIAGLTAA--NYDENFATLFKDTMVQLEQIVGQNMNMNHVFKH---------GSDTEQE 314
            .:.|::|:......  .::|....:|:.|...|::|...  |..|..|.         ||:.:.|
Mouse   312 AMSCINELMSKNCVPMEFEEYLLRMFQQTFYLLQKITKD--NNAHTVKSRLEELDESPGSEVKAE 374

  Fly   315 LVLNLAMFLCTFLKEHGKLVEDAKYVDYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNS 379
            ..|....::             .|:.|:|.  |...|.:..:|....|.: :|:    :..|:..
Mouse   375 RCLEAESYI-------------EKFTDFLR--LFVSVHLRRIESYSQFPV-VEF----LTLLFKY 419

  Fly   380 EFFHPTLES--------TKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEV----------LVVE 426
            .|..||.|.        |         .|...:.||::    ||:...|.|          |:.|
Mouse   420 TFHQPTHEGYFSCLDIWT---------LFLDYLTSKIK----SRLGDKEAVLNRYEDALVLLLTE 471

  Fly   427 NEN-----------GEVVREFMKDTNSINLYKNMRETL-VFLTHLDSVDTDRIMTLKLLNQVN-- 477
            ..|           .|:..|.:.|.......:.:|::| |....::.:.|....||..:.|.|  
Mouse   472 VLNRIQFRYNQAQLEELDDETLDDDQQTEWQRYLRQSLEVVAKVMELLPTHAFSTLFPVLQDNLE 536

  Fly   478 ------------GS---------------EFSWKNLNTLCWAIGSISGAFC-EEDEKRF--LVTV 512
                        ||               ..|.::|::|..|:|.::..|. :....||  .:||
Mouse   537 VYLGLQQFVVTSGSGHRLNITAENDCRRLHCSLRDLSSLLQAVGRLAEYFIGDVFAARFNDALTV 601

  Fly   513 IKDLLGLCEQKKGKDNK---------AIIASNIMYVVGQYPRFLRA--HWKFLKTVVNKLFEFMH 566
            ::.|:.:  ...|...|         :::..:::.|..|....|:|  ||         |.::..
Mouse   602 VERLVKV--TLYGSQIKLYNIETAVPSVLKPDLIDVHAQSLAALQAYSHW---------LAQYCG 655

  Fly   567 ETHDGVQDMACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGY 631
            |.|.               :..:.|||:           |.|||                :|:..
Mouse   656 EAHR---------------QNTQQFVTL-----------ISTTM----------------DAITP 678

  Fly   632 MISAQVDQVQQDVLIERYMQLPNQVWDDIISRASK-NVDFLKNMTAV-KQLGSIL---------K 685
            :||.:|    ||.|:.....|       ::|.|:. ...||.::.|| |...||:         |
Mouse   679 LISTKV----QDKLLLSACHL-------LVSLATTVRPVFLISIPAVQKVFNSIIDASAQRLTDK 732

  Fly   686 TNVAACKALGHAYVIQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNL 750
            ..|..|:||                                     :|..|:...::.:.|    
Mouse   733 AQVLVCRAL-------------------------------------SNTLLLPWPNLPESE---- 756

  Fly   751 ISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCKVPSAREP--KV-LSAMAIIVHK-------LR 805
             .:|..||.::        ..|:.|:..||...| |||..|  || |....:|:|:       :.
Mouse   757 -QQWPLRSINH--------ASLISALSRDYHSLK-PSATAPQRKVPLGDTKVIIHQTLSVLEDIV 811

  Fly   806 QHITNEVPKIFDAVFECTLDMINKNFEDFP---------QHRLSFYELLQAVNAHCFKAF---LN 858
            ::|:.|..|.....::...:.:..:...||         ...|||:..|       |:..   :.
Mouse   812 ENISGESTKSRQICYQSLQESVQVSLALFPAFIHQSDVTDEMLSFFLTL-------FRGLRVQMG 869

  Fly   859 IPPAQFKLVFDSVVWAFKH--TMRNVAD-------MGLNIL---FKMLQNLDQHPG--------- 902
            :|      ..:.::..|.:  |...:|:       .|..::   .|:||.:.|.||         
Mouse   870 VP------FTEQIIQTFLNMFTREQLAESILHEGSTGCRVVEKFLKILQVVVQEPGQVFKPFLPS 928

  Fly   903 -AAQSFYQTY-------FTDILMQIFSVVTDTSH---------------TAGLPNH--------- 935
             .|....|.|       ..|:..::|.::..|.|               ..|:...         
Mouse   929 IIALCMEQVYPIIAERPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFS 993

  Fly   936 AIILAYMFSLVENRKITVNLGPIPDNMIFIQE--YVASL-LKSAFTHLSDNQVKVF-VTGLF--- 993
            ||:.|:..|.::           ||..:|.|.  |:.:| .|....|     .|:| .|.||   
Mouse   994 AIMQAFGQSFLQ-----------PDIHLFKQNLFYLETLNTKQKLYH-----KKIFRTTMLFQFV 1042

  Fly   994 NLDENVQAFKEHLRDFL-----IQIREATGEDDSDLYLEEREAALAEE-----------QSN--- 1039
            |:...|...|.|  |.|     |.|......|....:     ||...|           |.|   
Mouse  1043 NVLLQVLVHKSH--DLLQEEIGIAIYNMASVDFDGFF-----AAFLPEFLTSCDGVDANQKNVLG 1100

  Fly  1040 -KHQMQRNIPGML-NPHELPEDMQ 1061
             ..:|.|::|... |.|.|..|::
Mouse  1101 RNFKMDRDLPSFTQNVHRLVNDLR 1124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 234/1269 (18%)
IBN_N 43..109 CDD:197981 13/69 (19%)
Xpo1 120..265 CDD:285575 38/221 (17%)
CRM1_C 701..1015 CDD:285920 74/401 (18%)
Xpo6XP_017167830.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.