DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and Xpo5

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_082474.1 Gene:Xpo5 MGIID:1913789 Length:1204 Species:Mus musculus

Alignment Length:1075 Identity:201/1076 (19%)
Similarity:365/1076 (34%) Gaps:327/1076 (30%)


  Fly    63 ILEYSQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKL 127
            :.|.:|....:.:.|||||.|:|.||..:.|.:...:|..|:.| |...:..|:.|:|.: .:.|
Mouse    54 LAEKTQIAIVRHFGLQILEHVVKFRWNSMSRLEKVYLKNSVMEL-IANGTLRILEEENHI-KDVL 116

  Fly   128 NMILVHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFS------QGQITQT 186
            :.|:|.::|||||::|...:.::....:..|:.....|.||..|:|:|..|.      :..|.||
Mouse   117 SRIVVEMIKREWPQHWPDMLMELDTLFRQGETQRELVMFILLRLAEDVVTFQTLPTQRRRDIQQT 181

  Fly   187 KAKHLKDTM----------CSEFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIF-- 239
            ..::::..:          .:::.|:.|..|...|...|..:....|.||..:::|:.|.:|.  
Mouse   182 LTQNMERILNFLLNTLQENVNKYQQMKTDSSQEAEAQANCRVSVAALNTLAGYIDWVSLNHITAE 246

  Fly   240 ETQQIETLIFKFLSVPMFRNVTLKCLSEIAGLTAANYDENFATLFKDTMVQLEQIVGQNMNMNHV 304
            ..:.:|||                ||.                                  :|  
Mouse   247 NCKLVETL----------------CLL----------------------------------LN-- 259

  Fly   305 FKHGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYVDYL--NQALMYLVMISEVED----VEVFK 363
                   ||||.|..|..|...:...||| ||.|.:..|  :.|:.|::..::..|    ||...
Mouse   260 -------EQELQLGAAECLLIAVSRKGKL-EDRKRLMILFGDVAMHYILSAAQTADGGGLVEKHY 316

  Fly   364 ICLE-------------------------------YWNS-LVEDLYNSEFF----HPTLESTKRQ 392
            :.|:                               |..| |....:.|:|.    |.|..:..|.
Mouse   317 LFLKRLCQVLCALGNLLCALLALDANIQTPINFGMYLESFLAFTTHPSQFLRSSTHMTWGALFRH 381

  Fly   393 QVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVR-EFMKDTNSINLYKNMR----ET 452
            :|..|......::.|.....::.:.|.......::.:.|..| :|..|.:....:.:.|    |.
Mouse   382 EVLSRDPALLAVIPKYLRASMTNLVKMGFPSKTDSPSCEYSRFDFDSDEDFNAFFNSSRAQHGEV 446

  Fly   453 LVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNT----LCWAIGSISGAFCE---------ED 504
            :..:..||...:.::....|..|::.|      ::|    .|...|:..|.||.         |.
Mouse   447 VRCVCRLDPKTSFQMAAEWLKYQLSAS------IDTGPVNSCSTAGTGEGGFCSIFSPSYVQWEA 505

  Fly   505 EKRFLVTVIK-----------------DLLGLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWK 552
            ...||.:||.                 :||.|....:.||  .::.|.::..|.....|:.....
Mouse   506 MTFFLESVINQMFRTLDKEELPVSDGIELLQLVLNFEIKD--PLVLSCVLTNVSALFPFVTYKPA 568

  Fly   553 FLKTVVNKLFEFMHETHDGVQDM--------------ACDTFIKIAIKCRRYFVTIQPNEACTFI 603
            ||..|.:|||.|:  |.:.|.:.              ||.:..|:   ||.|...:.||     .
Mouse   569 FLPQVFSKLFSFV--TFESVGESKAPRTRAVRNVRRHACSSINKM---CRDYPDLVLPN-----F 623

  Fly   604 DEILTTMSSIICD---LQPQQVHTFYEAVGYMISAQVDQVQQDVLIERYMQLPNQVW-DDIISRA 664
            |.:.:.:..::.:   |...:.....||:..:.:...|..:|.:.:|..|.....:| .:.:.||
Mouse   624 DMLYSHVKQLLSNELLLTQMEKCALMEALVLVSNQFKDYERQKLFLEELMAPVVNIWLSEEMCRA 688

  Fly   665 SKNVDFLKNMTAVKQLGSILKTNVAACK---ALGHAYVIQLGRIYLDMLNVYKITS-----ENII 721
            ..::|     :.:..:|:.||:...|.:   .|..|   ::......:|.|.:.||     |...
Mouse   689 LSDID-----SFIAYVGADLKSCDPAVEDPCGLNRA---RMSFCVYSILGVMRRTSWPSDLEEAK 745

  Fly   722 QAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCKVP 786
            ....|.|...:..|:.:          |..:|.:.|..||.|.:                     
Mouse   746 AGGFVVGYTPSGNPIFR----------NPCTEQILRLLDNLLAL--------------------- 779

  Fly   787 SAREPKVLSAMAIIVHKLRQHITNEVPKIFDAV---FECTLDMINK-------------NFEDFP 835
                             :|.|.|...|::...:   |...||::..             .|.|.|
Mouse   780 -----------------VRTHNTLYTPEMLTKMAEPFTKALDIVESEKTAILGLPQPLLEFNDHP 827

  Fly   836 QHRLS------FYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKML 894
            .:|.:      |:.:|.   .:|:.......|            :.:.....|.|:...:|....
Mouse   828 VYRTTLERMQRFFGILY---ENCYHILGKAGP------------SMQQDFYTVEDLASQLLGSAF 877

  Fly   895 QNLDQHPG-----------------AAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYM 942
            .||:..|.                 .....|:|..:.||..:|:.:           | :.|:..
Mouse   878 VNLNNIPDFRLRSMLRVFVKPLVLFCPSEHYETLISPILGPLFTYL-----------H-MRLSQK 930

  Fly   943 FSLVENRKITVNLGPI----PDNMIFIQEYVASLL 973
            :.::..|.|......|    |::...::|.:..:|
Mouse   931 WHVINQRSILCGEDEIAEDNPESQEMLEEQLVRML 965

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 201/1076 (19%)
IBN_N 43..109 CDD:197981 16/46 (35%)
Xpo1 120..265 CDD:285575 36/163 (22%)
CRM1_C 701..1015 CDD:285920 48/322 (15%)
Xpo5NP_082474.1 Necessary for interaction with Ran. {ECO:0000250|UniProtKB:Q9HAV4} 1..108 17/55 (31%)
IBN_N 33..100 CDD:197981 16/47 (34%)
Xpo1 109..271 CDD:285575 44/222 (20%)
Necessary for interaction with ILF3. {ECO:0000250|UniProtKB:Q9HAV4} 533..640 26/119 (22%)
Pre-siRNA binding. {ECO:0000250|UniProtKB:Q9HAV4} 641..642 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D40069at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.