DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and XPO5

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_065801.1 Gene:XPO5 HGNCID:17675 Length:1204 Species:Homo sapiens

Alignment Length:1129 Identity:225/1130 (20%)
Similarity:395/1130 (35%) Gaps:328/1130 (29%)


  Fly    63 ILEYSQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKL 127
            :.|.:|....:.:.|||||.|:|.||..:.|.:...:|..|:.||...:.: |:.|:|.: .:.|
Human    54 LAEKTQVAIVRHFGLQILEHVVKFRWNGMSRLEKVYLKNSVMELIANGTLN-ILEEENHI-KDAL 116

  Fly   128 NMILVHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLK 192
            :.|:|.::|||||::|...:.::...||..|:.....|.||..|:|:|..|.  .:...:.:.::
Human   117 SRIVVEMIKREWPQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTFQ--TLPPQRRRDIQ 179

  Fly   193 DTMCSEFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMF 257
            .|:.....:||:.....|:.::|                        :.||::|      .....
Human   180 QTLTQNMERIFSFLLNTLQENVN------------------------KYQQVKT------DTSQE 214

  Fly   258 RNVTLKCLSEIAGL-TAANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAM 321
            ......|...:|.| |.|.|.:         .|.:..|..:|..:..:.....: ||||.|..|.
Human   215 SKAQANCRVGVAALNTLAGYID---------WVSMSHITAENCKLLEILCLLLN-EQELQLGAAE 269

  Fly   322 FLCTFLKEHGKLVEDAK--YVDYLNQALMYLVMISEVED----VE---VF-------------KI 364
            .|...:...||| ||.|  .|.:.:.|:.|::..::..|    ||   ||             ::
Human   270 CLLIAVSRKGKL-EDRKPLMVLFGDVAMHYILSAAQTADGGGLVEKHYVFLKRLCQVLCALGNQL 333

  Fly   365 CL---------------EYWNS-LVEDLYNSEFFHPTLEST----KRQQVYPRRRFYAPILSKVR 409
            |.               :|..| |....:.|:|...:.:.|    .|.::..|......|:.|..
Human   334 CALLGADSDVETPSNFGKYLESFLAFTTHPSQFLRSSTQMTWGALFRHEILSRDPLLLAIIPKYL 398

  Fly   410 FIMISRMAKPEEVLVVENENGEVVR-EFMKDTNSINLYKNMR----ETLVFLTHLDSVDTDRIMT 469
            ...::.:.|.......::.:.|..| :|..|.:....:.:.|    |.:.....||.        
Human   399 RASMTNLVKMGFPSKTDSPSCEYSRFDFDSDEDFNAFFNSSRAQQGEVMRLACRLDP-------- 455

  Fly   470 LKLLNQVNGSEFSWKNLNTL--------CWAIGSISGAFCE---------EDEKRFLVTVI---- 513
             |...|:.|....:: |:|.        |.|:|:..|:.|.         |....||.:||    
Human   456 -KTSFQMAGEWLKYQ-LSTFLDAGSVNSCSAVGTGEGSLCSVFSPSFVQWEAMTLFLESVITQMF 518

  Fly   514 ----------KDLLGLCEQKKGKDNK-AIIASNIMYVVGQYPRFLRAHWKFLKTVVNKL-----F 562
                      .|.:.|.:.....|.| .:|.|.::..|.....|:....:||..|.:||     |
Human   519 RTLNREEIPVNDGIELLQMVLNFDTKDPLILSCVLTNVSALFPFVTYRPEFLPQVFSKLFSSVTF 583

  Fly   563 EFMHETH-------DGVQDMACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICD---L 617
            |.:.|:.       ..|:..||.:.||:   ||.|...:.||     .|.:...:..::.:   |
Human   584 ETVEESKAPRTRAVRNVRRHACSSIIKM---CRDYPQLVLPN-----FDMLYNHVKQLLSNELLL 640

  Fly   618 QPQQVHTFYEAVGYMISAQVDQVQ-QDVLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLG 681
            ...:.....||: .:||.|....: |.|.:|..|.....:|   :|:     |..:.::.|....
Human   641 TQMEKCALMEAL-VLISNQFKNYERQKVFLEELMAPVASIW---LSQ-----DMHRVLSDVDAFI 696

  Fly   682 SILKTNVAACKALGHAYVIQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKE 746
            :.:.|:..:|.. |......|.|..:... ||.|                        :.|||:.
Human   697 AYVGTDQKSCDP-GLEDPCGLNRARMSFC-VYSI------------------------LGVVKRT 735

  Fly   747 TLNLISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCKVPSAREP---KVLSAMAIIVHKLRQHI 808
            .      |.:...:.:          ....::.|.....|..|.|   ::|..:..::..:|.|.
Human   736 C------WPTDLEEAK----------AGGFVVGYTSSGNPIFRNPCTEQILKLLDNLLALIRTHN 784

  Fly   809 TNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFKL----VFD 869
            |...|           :|:.|..|.|.:    ..::|.|..:    |.|.:|....:|    ||.
Human   785 TLYAP-----------EMLAKMAEPFTK----ALDMLDAEKS----AILGLPQPLLELNDSPVFK 830

  Fly   870 SVVWAFKHTMRNVADMGLNILFKMLQNLDQHPGAAQSFYQTYFT--DILMQIFSVVTDTSHTAGL 932
            :|:...:.....:.:...:||.|          |..|..|.::|  |:..|:.|           
Human   831 TVLERMQRFFSTLYENCFHILGK----------AGPSMQQDFYTVEDLATQLLS----------- 874

  Fly   933 PNHAIILAYMFSLVENRKITVNLGPIPDN------MIFI------------QEYVASLLKSAFTH 979
                             ...|||..|||.      .:|:            :..|:.:|...||:
Human   875 -----------------SAFVNLNNIPDYRLRPMLRVFVKPLVLFCPPEHYEALVSPILGPLFTY 922

  Fly   980 LS---------DNQVKVFVTGLFNLDENVQAFKEHLRDFLIQI--RE------------------ 1015
            |.         .||..:........|||.:: :|.|.:.|:::  ||                  
Human   923 LHMRLSQKWQVINQRSLLCGEDEAADENPES-QEMLEEQLVRMLTREVMDLITVCCVSKKGADHS 986

  Fly  1016 ----ATGEDDSDLYLEEREAALAE 1035
                |.|:|:..:..|...:|:||
Human   987 SAPPADGDDEEMMATEVTPSAMAE 1010

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 221/1116 (20%)
IBN_N 43..109 CDD:197981 16/46 (35%)
Xpo1 120..265 CDD:285575 29/145 (20%)
CRM1_C 701..1015 CDD:285920 62/352 (18%)
XPO5NP_065801.1 Necessary for interaction with Ran 2..108 17/55 (31%)
IBN_N 33..100 CDD:197981 16/46 (35%)
Xpo1 109..248 CDD:312035 37/181 (20%)
Necessary for interaction with ILF3 533..640 26/115 (23%)
Pre-miRNA binding. {ECO:0000269|PubMed:19965479} 641..642 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D40069at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.