DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and xpo5

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_017214411.1 Gene:xpo5 ID: Length:1216 Species:Danio rerio

Alignment Length:1089 Identity:211/1090 (19%)
Similarity:373/1090 (34%) Gaps:334/1090 (31%)


  Fly    25 LDKIVEVVYTAQGEQ-LRL-AQSILTTLKEHPEAWTRVD-SILEYSQNQRTKFYALQILEEVIKT 86
            |.|.|.|:..|:..| .|| |...:...||......... .:.|.||....:.:.|||||.|:|.
Zfish    12 LIKAVNVMMEAESSQTYRLEAFKFIEDFKEKSPFCVECGLQLAEKSQTAVIRHFGLQILEHVVKF 76

  Fly    87 RW-KVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILVHILKREWPRNWETFISDI 150
            || .:.|:::.: :|...:.: :...:.||:.|:..| .:.|:.|:|.::|||||:.|...:.::
Zfish    77 RWNNMAPQDKLQ-LKNCTMGM-LSNGTHPILQEECHV-KDALSRIVVEMIKREWPQQWPDMLKEM 138

  Fly   151 VGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTLCSFVLENSMN 215
            ...:...::.....|::|..|:|:|..|.  .:...:.:.::.|:......:||....:|:..:|
Zfish   139 EALTALGDAQTELVMLVLLRLAEDVITFQ--TLPSQRRRDIQQTLTQNMDSVFTFLLGILQLHVN 201

  Fly   216 --------AAL-----IHV-----TLETLLRFLNWIPLGYIFETQQ----IETLIFKFLSVPMFR 258
                    |.|     .|:     ||.||..:::|:.|.:|  |.|    :|.|.. .||.|..:
Zfish   202 EYSKMKCVAGLDLKMKAHLRVGVATLNTLAGYIDWVSLSHI--TSQNCRLLEILCL-LLSEPELQ 263

  Fly   259 NVTLKCL-------------------------------------SEIAGLTAANYDENFATLFKD 286
            ....:||                                     :.:...::...||...|..|.
Zfish   264 LEAAECLLIAISRKGKLEERKPFMVLFDEAAMNYILSAAQSADGAALCNQSSGGIDERRYTFLKR 328

  Fly   287 TMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYVDYLNQALMYLV 351
            ....|..:..|..::     .|||.|.::.:||..:|...|   ......::::....|....::
Zfish   329 LCQVLCALGSQVCSL-----VGSDVEVQVPVNLNKYLEALL---AFTTHPSQFLRSSTQMTWGII 385

  Fly   352 MISEV--EDVEVFKICLEYWN----SLVE-----------------DLYNSEFFHPTLESTKRQQ 393
            ...|:  :|..|.::.::|..    :||:                 |..:.|.|:.:..|::.||
Zfish   386 FRHEILSKDPVVGQMAIKYLRATRINLVKTGFPSKNDCPGCEFSRVDFDSDEDFNSSFNSSRAQQ 450

  Fly   394 ---------VYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLYKNM 449
                     :.|.:.|                              ::.|::|:...|       
Zfish   451 GEAVRLTCRIVPFKAF------------------------------QIARDWMQYQIS------- 478

  Fly   450 RETLVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIK 514
                   |.:|:..|.......|.:.::.|...|:.:.|                   |...|..
Zfish   479 -------TPIDAGKTTAKTEKGLCSPLSPSVVQWEAMTT-------------------FTENVFG 517

  Fly   515 DLLGLCEQKK---------------GKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKL--- 561
            .|..:.|::|               .:....:|.|.::.:|......|.....||..|:.|:   
Zfish   518 QLFKILEKEKLPIDEGMALLQIAVNFETRDPLILSCVLTIVSTLFPILTHRPHFLPQVLFKIFSA 582

  Fly   562 --FEFMHETH-------DGVQDMACDTFIKIAIKCRRY-------FVTIQPNEACTFIDEILTTM 610
              ||.:.|..       ..|:..||.:.|:|   ||.|       |..:..:....|.||:|.|.
Zfish   583 ITFELVDERKAPRTRAVKNVRRHACSSIIRI---CRDYSDFMLPCFDLMYEHVKRLFSDELLLTQ 644

  Fly   611 SSIICDLQPQQVHTFYEAVGYMISAQV-DQVQQDVLIERYMQLPNQVWDDIISRASKNV-----D 669
            .. .|.|.        ||: .:||.|. |..:|...:|..|.....:|   :|...::|     .
Zfish   645 LE-KCALM--------EAL-ILISNQFKDYKKQKAFLEELMAPVTALW---LSEEMRSVLWDPAT 696

  Fly   670 FLKNMTAVKQLG--------SILKTNVAAC--KALGHAYVIQLGRIYLDMLNVYKITSENIIQAI 724
            ||..:.|.:::.        .|.::.::.|  ..||   |::..|...|   ..:..:...:...
Zfish   697 FLTFVGADQEISDSDTDEQMGINRSRISLCVHTILG---VVKRARWPAD---ADQAKAGGFVVRT 755

  Fly   725 EVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCKVPSAR 789
            ..:|..|...|..:.:..:....|.||     |:| |.|    |:|                   
Zfish   756 ASDGTPVYRNPCAEALQALLPNLLALI-----RTN-NSL----FLP------------------- 791

  Fly   790 EPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFYELLQAVNAHCFK 854
                            ::|| .:.|.|..|::.| ||.........|..|..||      |..:|
Zfish   792 ----------------ENIT-RLSKTFARVYDIT-DMEKNCVLGISQVVLDSYE------AAVYK 832

  Fly   855 AFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLDQHPGAAQSFYQTYFTDILMQI 919
            .|.......|..:|::..    |.:.||.                 |...|.||.  ...:..||
Zfish   833 NFAERMQGFFSSLFENCY----HVLGNVG-----------------PCLQQDFYG--IEGLAEQI 874

  Fly   920 FSVVTDTSHTAGLPNH---AIILAYMFSLV-------ENRKITVNLGPI 958
              |.:..:|...:|:|   .:|..:|..||       .:|.:...|||:
Zfish   875 --VGSAFNHLDSVPDHRLRPLIRLFMKQLVISCPHEYYDRLLCPLLGPL 921

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 211/1090 (19%)
IBN_N 43..109 CDD:197981 17/68 (25%)
Xpo1 120..265 CDD:285575 39/167 (23%)
CRM1_C 701..1015 CDD:285920 52/269 (19%)
xpo5XP_017214411.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D40069at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.