DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and xpo1a

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_009292977.1 Gene:xpo1a ZFINID:ZDB-GENE-050309-201 Length:1071 Species:Danio rerio

Alignment Length:1065 Identity:752/1066 (71%)
Similarity:887/1066 (83%) Gaps:8/1066 (1%)


  Fly     3 TMLTSDEAGKLLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYS 67
            |||....|.:||||||||||||||.:|..:|...|.|.||||.:||.||:||:||||||:|||:|
Zfish     6 TMLADHTARQLLDFSQKLDINLLDNVVNSMYYDVGSQQRLAQEVLTNLKDHPDAWTRVDTILEFS 70

  Fly    68 QNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILV 132
            ||.:||:|||||||.|||||||:||||||||||||||.||||||||...:|:.:||::|||||||
Zfish    71 QNMKTKYYALQILETVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDANSVEKEQVYISKLNMILV 135

  Fly   133 HILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCS 197
            .|||:|||::|.||||||||||:|:||||.|||:|||.|||||||||.||:||.|||||||:||:
Zfish   136 QILKQEWPKHWPTFISDIVGASRTSESLCQNNMIILKLLSEEVFDFSSGQMTQVKAKHLKDSMCN 200

  Fly   198 EFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNVTL 262
            ||||||.||.||:|||.||.|:|.||||||||||||||||||||:.|.||::|||:|||||||||
Zfish   201 EFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLVYKFLNVPMFRNVTL 265

  Fly   263 KCLSEIAGLTAANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFL 327
            |||:||||::.:.|:|.|..||..||:||:|::..|.|:...:.:|.|.||..:.||::||||||
Zfish   266 KCLTEIAGVSVSQYEEQFVNLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFL 330

  Fly   328 KEHGKLVEDAKYV-DYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNSEFF----HPTLE 387
            ||||:|:|....: :.|.:||.|::::||||:.|:|||||||||.|..:||....|    .|.|.
Zfish   331 KEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSTSPLLS 395

  Fly   388 STKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLYKNMRET 452
            :::...|.|||..|.|:|||||.:|:||||||||||||||:.|||||||||||:|||||||||||
Zfish   396 TSQHFDVPPRRHLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRET 460

  Fly   453 LVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIKDLL 517
            ||:|||||..||:||||.||.|||||:|:||:|||||||||||||||..||||||||||||||||
Zfish   461 LVYLTHLDYADTERIMTEKLHNQVNGTEWSWRNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLL 525

  Fly   518 GLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIK 582
            ||||||:||||||||||||||:|||||||||||||||||||||||||||||||||||||||||||
Zfish   526 GLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIK 590

  Fly   583 IAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVLIE 647
            ||.||||:||.:|..|...||||||..:::|||||||||||||||||||||.||.||..|:.|||
Zfish   591 IAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQERLIE 655

  Fly   648 RYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRIYLDMLNV 712
            :||.|||||||.||.:|:||||.||:...|:||||||||||.||||:||.:|:||||||||||||
Zfish   656 KYMLLPNQVWDSIIQQATKNVDILKDPETVRQLGSILKTNVRACKAVGHPFVLQLGRIYLDMLNV 720

  Fly   713 YKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLLDAIL 777
            ||..||||..||:.||..|..||||::|..||:|||.|||.|||||||.|:|.:||:||||:|:|
Zfish   721 YKCLSENISSAIQSNGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVGENFVPPLLEAVL 785

  Fly   778 LDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFY 842
            :|||| .||:||||:|||.||.||:||..|||.|:||||||||||||:|||||||:||:||..|:
Zfish   786 IDYQR-NVPAAREPEVLSTMATIVNKLGSHITGEIPKIFDAVFECTLEMINKNFEEFPEHRTHFF 849

  Fly   843 ELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLDQHPGAAQSF 907
            .||||||:.||.|||:|||||||||.||::||||||||||||.||.|||.||||:.|...|||||
Zfish   850 YLLQAVNSQCFPAFLSIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTMLQNIAQEEAAAQSF 914

  Fly   908 YQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITV--NLGPIPDNMIFIQEYVA 970
            |||||.|||..||||||||||||||..||.||||||:|||..||:|  |.|...:|..::|:|||
Zfish   915 YQTYFFDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISVALNAGTAGNNQGYVQDYVA 979

  Fly   971 SLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYLEEREAALAE 1035
            :|||:||.||.|.||||||||||:|::::.||||||||||:||:|..|||.:||:||||||:|.:
Zfish   980 NLLKTAFPHLQDAQVKVFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDSTDLFLEEREASLRQ 1044

  Fly  1036 EQSNKHQMQRNIPGMLNPHELPEDM 1060
            .|..||::|.::||:||||||||:|
Zfish  1045 AQEEKHKIQLSVPGILNPHELPEEM 1069

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 724/1017 (71%)
IBN_N 43..109 CDD:197981 53/66 (80%)
Xpo1 120..265 CDD:285575 113/145 (78%)
CRM1_C 701..1015 CDD:285920 223/316 (71%)
xpo1aXP_009292977.1 CRM1 15..1049 CDD:227432 734/1035 (71%)
IBN_N 46..112 CDD:197981 53/66 (80%)
Xpo1 123..268 CDD:285575 113/145 (78%)
CRM1_C 709..1027 CDD:198170 224/319 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25282829
eggNOG 1 0.900 E1_COG5101
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1512 1.000 Inparanoid score I95
OMA 1 1.010
OrthoDB 1 1.010 D132850at2759
OrthoFinder 1 1.000 FOG0002975
OrthoInspector 1 1.000 T597149
orthoMCL 1 0.900 OOG5_127698
Panther 1 1.100 O PTHR11223
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.