DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and ebo

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_001284739.1 Gene:ebo FlyBaseID:FBgn0266572 Length:1054 Species:Drosophila melanogaster

Alignment Length:1216 Identity:218/1217 (18%)
Similarity:431/1217 (35%) Gaps:355/1217 (29%)


  Fly     2 ATMLTSDEAGKLLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAW---TRVDSI 63
            |..||:.| |.|.:|.|....|...:.:|              :.|...|..||||   .||.:.
  Fly     3 AASLTTVE-GLLQEFYQPSTSNARKREIE--------------TNLLAFKSQPEAWQLCLRVATS 52

  Fly    64 LEYSQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLN 128
            .:.::||...|::...||..|..||..|.......:::.:.:...:..:.|.|.::::   :.|.
  Fly    53 SDTTENQFLWFFSTSTLEHTITRRWTQLTSTDKTLLRETLWNSYAQLVATPNVAKRHR---DTLA 114

  Fly   129 MILVHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKD 193
            .::..:.|||:|.....::...:..:||...|.:|   :||..||||.. ::|.:|         
  Fly   115 QLIALLGKREFPEQDPNYMQHCMELTKTRFQLGIN---LLKITSEEVVS-NRGDLT--------- 166

  Fly   194 TMCSEFSQIF-------------------------------------TLCSFVL------ENSMN 215
               :|:.|.|                                     ||..|.|      :|.::
  Fly   167 ---TEWKQYFYSCISMCVPDVLDLVTKYLLIAVCHINGKDIQTTIPNTLMDFSLTSALPNDNQLS 228

  Fly   216 AALIHVTLETLLRFLNWIPLGYIFETQQI-ETLIFKFLSV----PMFRNVTLKCLSEIAGLTAAN 275
            ::::.: |..:...::||      .|:.| |..:...|.:    |....::|..||.:..|....
  Fly   229 SSILDL-LGCVQHLVSWI------RTELISEYFLMSILDLSQWRPAHEPISLAALSVLNELLYLQ 286

  Fly   276 YDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYV 340
            ....|.......:..|.:....|...:.::   ||..:||   |.::.   .|...||:::...:
  Fly   287 KPLPFPGPLMGGVTSLLEQHNNNRRQSEMY---SDKFREL---LRLYT---TKYAAKLMQEPDLL 342

  Fly   341 D-YLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNSEFFHPTLESTKRQQVYPRRRFYAPI 404
            : :||  |:| ...:|:.....|...||.|..:::.:..    ||. :.|:...|.  .:....|
  Fly   343 ETFLN--LLY-SCTTELHGALDFTEKLEIWTPIIKGIAQ----HPA-KITRYNNVL--TQLVDEI 397

  Fly   405 LSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNS--------------------------- 442
            :.:.:|     .|...|:.|::|       |.|:|..|                           
  Fly   398 MRRTQF-----EANKPELEVLDN-------ELMEDDTSATEWQQFLDQCFESLALLANTRGAHIV 450

  Fly   443 -INLYKNMRETLVFLTHLD-SVDTDRIMTLKLLNQVNGSEFS--WKNLNTLCWAI-------GSI 496
             ..:|.:.....::|..|: ::|.....:.:...::.|:...  .::..|:|.|:       .|.
  Fly   451 FAQVYNHWSRPQMYLLSLEHALDHGSARSYEAARKLKGANVGEILRDFATVCQAVVRLAPLMDSS 515

  Fly   497 SGAFCEEDEKRFLVTVIKDLLGLCEQKKGKDNKAIIASNIMYVVGQ--------------YPRFL 547
            :.|....||....:.::.|.|        .....::|||.:|..|.              |.:.|
  Fly   516 TAAPGVADEMECQLQMLSDSL--------LQTLQLLASNRLYSGGSEMDKATFQTDLDNLYAQVL 572

  Fly   548 ---RAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAIKCRRYFVTIQP--NEACTFIDEIL 607
               |:.:...|.:..:  |.:|...         ..:.....|........|  .:|.:   |:|
  Fly   573 LAMRSIFPLTKAMSGE--ELLHRLF---------AILGSIFACNGSLTAASPIVQQAAS---ELL 623

  Fly   608 TTMSSII---CDLQPQQVHTFYEAVGYMISAQVDQ---VQQDVLIERYMQLPNQVWDDIISRASK 666
            ..:|::|   |.|...|:.:..:| |..:.||:.:   :...:.:..||.||   |..:   ..:
  Fly   624 LFISTVIRPKCLLDIPQIQSLLQA-GSRLGAQLPRQVCINVHISLVSYMVLP---WKSV---PEQ 681

  Fly   667 NVDFLKNMTAVKQ-------------LGSILKTNVAACKALGHAYVIQLGRIYLDMLNVYKITSE 718
            ..::.:.:..:::             ||...::.|||.       .:.|...:..::..:|.|..
  Fly   682 QQEYPRRLWMLREYVQGLAQNFLDLDLGQANESKVAAT-------TLSLLGTFTALIEYFKATGG 739

  Fly   719 N---------------------------IIQAIEVNGVNVNNQPLIKTM--HVVKKETLNLISEW 754
            |                           |..||.|...:::   :::|:  |:..:....:|:.:
  Fly   740 NAKDMLASTFKPILTKALMIFNNFGQSSIAMAITVAEFSLS---MLRTLPTHLGAQFIKEMITLF 801

  Fly   755 VSRSNDNQLVMDNFIPPLLDAILLDYQRCKV----PSARE----PKVLS-AMAIIVHKLRQ---- 806
            :|.|:..||.:...  .:::.||   |..|:    |.:..    |.:|. :...|:..|:|    
  Fly   802 ISVSSREQLTLSRL--AVMEKIL---QMFKLIVEQPGSASLGLLPSILDFSTQQILPLLQQQNAA 861

  Fly   807 ----HITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFYELLQAVNAHC------FKAFLNIPP 861
                .||:.:..:||:|..|......||               |..|.|.      |....|:.|
  Fly   862 TDNSEITSLLYALFDSVLTCKWQFFYKN---------------QLSNGHSGGGSGNFNCSDNLHP 911

  Fly   862 AQFKLVFDSVVWAFKHTMRNVADMG--LNILFKMLQNLDQHPGAAQSFYQTYFTDILMQIFSVVT 924
            |.|..:.:    |:...:.:..|..  .::||.| ||:::.   ::.:.:..|.:.|:..|....
  Fly   912 AHFMAILN----AYGQMLVSGTDPSNVRSVLFSM-QNVNER---SRLYQRALFKEQLLASFQRAL 968

  Fly   925 DTSHTAGLPN-HAIILA---YMFSLVENRKITVNLGPIPDNMIFIQEYVASLLKSAFTHLSD--- 982
            .....:|..: |..::|   |....|:.|::             ::.:|.:.|..|.|.|.:   
  Fly   969 LNLLLSGEGSLHFDMIAQALYAMGQVDRRQL-------------LESFVHASLPVAQTSLEEICQ 1020

  Fly   983 NQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYLEE 1028
            ..|..|:.      :::..|.:.|...:        :|...::|.|
  Fly  1021 TNVLPFIV------QDIPTFTQKLTQLM--------QDAHCVHLNE 1052

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 211/1199 (18%)
IBN_N 43..109 CDD:197981 17/69 (25%)
Xpo1 120..265 CDD:285575 34/193 (18%)
CRM1_C 701..1015 CDD:285920 66/375 (18%)
eboNP_001284739.1 IBN_N 30..98 CDD:281761 18/82 (22%)
Xpo1 110..259 CDD:285575 31/175 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.