DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and xpo5

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_989112.2 Gene:xpo5 XenbaseID:XB-GENE-5947328 Length:1207 Species:Xenopus tropicalis

Alignment Length:1004 Identity:176/1005 (18%)
Similarity:343/1005 (34%) Gaps:247/1005 (25%)


  Fly    67 SQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMIL 131
            |.:...:.:.|.:||.|||.||..:.|.:...:|..|:.| |.....||:.|::.: .:.:..|:
 Frog    57 SHSPCVRHFGLHVLEHVIKFRWNDMSREEKVCLKDSVMDL-ISHGMHPILEEESHI-KDMMARIV 119

  Fly   132 VHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMC 196
            |.:.|||||::|...::::...::..|:.....|.||..|:|:|..| |...|| :.:.::.||.
 Frog   120 VEMAKREWPQHWPDLLNELDSLTRVGEAQTELVMFILLRLAEDVVTF-QNLPTQ-RRRDIQTTMT 182

  Fly   197 SEFSQIFTLCSFVLE--------------NSMNA----ALIHVTLETLLRFLNWIPLGYIF-ETQ 242
            .:...:|.....:|:              ||:.|    .:...:|:||..:::|:.:.:|. :..
 Frog   183 QKMDVLFAFMLNILQQSVQQYQHLKTDPANSVKAQGMCRVAVASLKTLAGYIDWVAITHIMADNC 247

  Fly   243 QIETLIFKFLSVPMFRNVTLKCLSEIAGLTAANYDEN--FATLFKDTMVQLEQIVGQNMNMNHVF 305
            ::..::...||.|..:....:||. ||.......::.  ...||.|..::....|.|.       
 Frog   248 KLLGMLCVLLSEPELQLEAAECLL-IAVSRKGKLEDRIPLLILFGDEAIEYILSVAQM------- 304

  Fly   306 KHGSDTEQ-------------ELVLNLAMFLCTFLKEHG-KLVEDAKYVDYLNQALMYLVMISEV 356
               :|||.             :|:..|...:|...:... |:.....:..||...|.:....|:.
 Frog   305 ---ADTETLEEKRYILLKRICQLICTLGTQICALTQSPDLKVNVPGNFNKYLETLLSFTRHASQF 366

  Fly   357 EDVEVFKICLEYWNSLVEDLYNSEFFHPTLESTKRQQVYPRRRFYAPILSKVRFIMISRMAKPEE 421
                :....:..|.::        |.|..|..      :|:.....|...:...:.|.|:..|.:
 Frog   367 ----LTSSTILTWGTI--------FRHEVLSR------HPQLLAAIPDFLRSSMVSIVRVGFPSK 413

  Fly   422 VLVVENENGEVVREFMKDTNS-INLYKNM--------------------RETLVF--LTHLDSVD 463
            ......:...:..|..:|.|. .|.::.:                    :|.|.|  ...||...
 Frog   414 DNSPSCKYSRMDYESDEDFNGFFNSFRALMGGVVRAACYLDPHTGFCIAKEWLQFQLSAPLDPGP 478

  Fly   464 TDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIKDL-----LGLCEQK 523
            .:......|.:..:.|...|:.:...|..:.|          :.|.|...::|     :||.:|.
 Frog   479 HNAQPGDALCSPTSTSFLQWEAMTFFCECVTS----------QLFRVVPKEELPVAEGIGLLQQV 533

  Fly   524 KGKDN-KAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDG------------VQDM 575
            ...:. ..:|.|.::..:.....|:.....::..|::||.:.:.....|            |:..
 Frog   534 LSYETMDPLILSFVLTNLSSLMPFITCLSSYVPPVLSKLLDAISFPLSGDMKVSKSRGEMNVRRH 598

  Fly   576 ACDTFIKIAIKCRRYFVTIQPN--------EACTFIDEILTTMSSIICDLQP------------- 619
            |..:.||:   ||.|...:||:        .|....:::||.|..  |.|..             
 Frog   599 ANSSLIKV---CRDYPELVQPHFEQLHARVTALLGEEQLLTQMGK--CALMEALILASNQFKSYD 658

  Fly   620 -QQVHTFYEAVGYMISAQVDQVQQDVLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSI 683
             ||| ...|.:|.::|..|.:..|     |....|    |:.||..  ..|.|.:....:..|:.
 Frog   659 RQQV-LLEELIGPLVSGCVSEKTQ-----RAFSGP----DEFISFV--GADILMHQQEEEDRGAP 711

  Fly   684 LKTNVAACKALGHAYVIQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETL 748
            .::.::.|                                            ....:.:||:   
 Frog   712 SRSQLSLC--------------------------------------------TFALLGMVKR--- 729

  Fly   749 NLISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCKVPSAREP------KVLSAMAIIVHKLRQH 807
               |:|.:...:.:          ....::.|.....|..|.|      |||.::..::..:...
 Frog   730 ---SQWPTDPEEAK----------AGGFVIGYSASGAPLLRNPGARLLLKVLDSLLALIRTMNNL 781

  Fly   808 ITNEVPKIFDAVFECTLDMI---NKNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFKLVFD 869
            ...||.......|..:|:|:   .|......|..:...:|....|....:.|       |..:||
 Frog   782 YLPEVMGKMGDTFCKSLNMLAMDRKLLMGTSQSAIEDCDLPAKTNLSRIQFF-------FASLFD 839

  Fly   870 SVVW-------AFKHTMRNVADMGLNILFKMLQNLDQHPGAAQSFYQTYFTDILMQ--IFSVVTD 925
            :...       :..|...:|.|:...:|..:..|.|..|    .:.......:|::  |.|...:
 Frog   840 NCCQILGHCGPSMPHEFYSVPDLASRLLSSVFTNADNVP----DYRLRLILRVLVKPLILSCPAE 900

  Fly   926 TSHTAGLPNHAIILAYMFSLVENRKITVN 954
            ...:...|....::.|::..:..:.:::|
 Frog   901 KYESLVCPILGPLIIYLYQRLSQKWLSIN 929

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 176/1005 (18%)
IBN_N 43..109 CDD:197981 14/42 (33%)
Xpo1 120..265 CDD:285575 35/164 (21%)
CRM1_C 701..1015 CDD:285920 37/273 (14%)
xpo5NP_989112.2 IBN_N 32..99 CDD:197981 14/43 (33%)
Xpo1 108..270 CDD:285575 35/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D40069at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.