DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and Xpo5

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_001102259.2 Gene:Xpo5 RGDID:1311522 Length:1204 Species:Rattus norvegicus

Alignment Length:1054 Identity:200/1055 (19%)
Similarity:374/1055 (35%) Gaps:285/1055 (27%)


  Fly    63 ILEYSQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKL 127
            :.|.:|....:.:.|||||.|:|.||..:.|.:...:|..|:.||...:.. |:.|:|.: .:.|
  Rat    54 LAEKTQIAIVRHFGLQILEHVVKFRWNSMSRLEKVYLKNSVMELIANGTLS-ILEEENHI-KDVL 116

  Fly   128 NMILVHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFS------QGQITQT 186
            :.|:|.::|||||::|...:.::...|:..|:.....|.||..|:|:|..|.      :..|.||
  Rat   117 SRIVVEMIKREWPQHWPDMLMELDTLSRQGETQRELVMFILLRLAEDVVTFQTLPTQRRRDIQQT 181

  Fly   187 KAKHLKDTM----------CSEFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIF-- 239
            ..::::..:          .:::.|:.|..|...|...|..:....|.||..:::|:.|.:|.  
  Rat   182 LTQNMERILNFLLSTLQENVNKYQQMKTDASQEAEAQANCRVSIAALNTLAGYIDWVSLNHITAE 246

  Fly   240 ETQQIETLIFKFLSVPMFRNVTLKCLSEIAGLTAANYDENFATLFKDTMVQLEQIVGQNMNMNHV 304
            ..:.:|||                ||.                                  :|  
  Rat   247 NCKLVETL----------------CLL----------------------------------LN-- 259

  Fly   305 FKHGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYVDYL--NQALMYLVMISEVED----VEVFK 363
                   ||||.|..|..|...:...||| ||.|.:..|  :.|:.|::..::..|    ||...
  Rat   260 -------EQELQLGAAECLLIAVSRKGKL-EDRKRLMILFGDVAMHYVLSAAQTADGGGLVEKHY 316

  Fly   364 ICLE-------------------------------YWNS-LVEDLYNSEFF----HPTLESTKRQ 392
            :.|:                               |..| |....:.|:|.    |.|..:..|.
  Rat   317 LFLKRLCQVLCALGNLLCALLALDANIQTPVNFGMYLESFLAFTTHPSQFLRSSTHMTWGALFRH 381

  Fly   393 QVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVR-EFMKDTNSINLYKNMR----ET 452
            :|..|......::.|.....::.:.|.......::.:.|..| :|..|.:....:.:.|    |.
  Rat   382 EVLSRDPSLLAVIPKYLRASMTNLVKMGFPSKTDSPSCEYSRFDFDSDEDFNAFFNSSRAQHGEV 446

  Fly   453 LVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCE---------EDEKRF 508
            :..:..||. .|...|..:.|.....:......:|: |...|:..|.||.         |....|
  Rat   447 VRCVCRLDP-KTSFQMAAEWLKYQLSAAIDTGPVNS-CSTAGTGEGGFCSIFSPSYVQWEAMTFF 509

  Fly   509 LVTVIKDLLGLCEQKKGKDNKAI---------------IASNIMYVVGQYPRFLRAHWKFLKTVV 558
            |.:||..:....|:::...|:.|               |.|.::..|.....|:.....||..|.
  Rat   510 LESVINQMFRTLEKEELPVNEGIELLQLVLNFEMKDPLILSCVLTNVSALFPFVTYKPAFLPQVF 574

  Fly   559 NKLFEFMHETHDGVQDM--------------ACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTT 609
            :|||.|:  |.:.|.:.              ||.:..|:   ||.|...:.||     .|.:.:.
  Rat   575 SKLFSFV--TFESVGESKAPRTRAVRNVRRHACSSINKM---CRDYPDLVLPN-----FDMLYSH 629

  Fly   610 MSSIICD---LQPQQVHTFYEAVGYMISAQVDQVQQDVLIERYMQLPNQVW-DDIISRASKNVDF 670
            :..::.:   |...:.....||:..:.:...|..:|.:.:|..|.....:| .:.:.||..::| 
  Rat   630 VKQLLSNELLLTQMEKCALMEALVLVSNQFKDYERQKLFLEELMAPVVNIWLSEEMCRALSDID- 693

  Fly   671 LKNMTAVKQLGSILKT-NVAACKALGHAYVIQLGRIYLDMLNVYKI-------TSENIIQAIEVN 727
                ..:..:|:.||: :.||....|      |.|..:... ||.|       |..:.::..:..
  Rat   694 ----AFIAYVGADLKSCDPAAQDPCG------LNRARMSFC-VYSILGVMRRTTWPSDLEEAKAG 747

  Fly   728 GVNV----NNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDN-----FIPPLLDAI------- 776
            |..|    :..|:.:          |..:|.:.|..||.|.:..     :.|.:|..:       
  Rat   748 GFVVGYTPSGNPVFR----------NPCTEQILRLLDNLLALVRTHNTLYTPEMLTKMAEPFTKA 802

  Fly   777 --LLDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRL 839
              :::.::..:....:|    .:.|..|.:.:.|...:.:.|..::|....::.|   ..|..:.
  Rat   803 LDIVESEKTAILGLPQP----LLEINDHPVYRTILERMQRFFGILYENCYHILGK---AGPSMQQ 860

  Fly   840 SFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFK------MLQNLD 898
            .||.:..........||:|                    :.|:.|..|..:.:      :|....
  Rat   861 DFYTVEDLATQLLGSAFVN--------------------LNNIPDFRLRSMLRVFVKPLVLFCPP 905

  Fly   899 QHPGAAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNLGPI----P 959
            :|       |:|..:.||..:|:.:           | :.|:..:.::..|.:......|    |
  Rat   906 EH-------YETLISPILGPLFTYL-----------H-MRLSQKWHVINQRSVLCGEDEIAEDNP 951

  Fly   960 DNMIFIQEYVASLL 973
            ::...::|.:..:|
  Rat   952 ESQEMLEEQLVRML 965

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 200/1055 (19%)
IBN_N 43..109 CDD:197981 16/46 (35%)
Xpo1 120..265 CDD:285575 37/163 (23%)
CRM1_C 701..1015 CDD:285920 47/309 (15%)
Xpo5NP_001102259.2 IBN_N 33..100 CDD:197981 16/46 (35%)
Xpo1 109..271 CDD:285575 45/222 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D40069at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.