DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and crm1

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_001342911.1 Gene:crm1 PomBaseID:SPAC1805.17 Length:1078 Species:Schizosaccharomyces pombe

Alignment Length:1077 Identity:526/1078 (49%)
Similarity:744/1078 (69%) Gaps:30/1078 (3%)


  Fly    13 LLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYAL 77
            :|.|.::||:.|||::|:..|...|.:.:.||.:||..:.||:||::..||||.|:..:||:.||
pombe     4 ILAFDRELDVALLDRVVQTFYQGVGAEQQQAQQVLTQFQAHPDAWSQAYSILEKSEYPQTKYIAL 68

  Fly    78 QILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILVHILKREWPRN 142
            .:|:::|.||||:||:.|..||:.|:|:::||.|||..|::|.|.:||||::.||.|||:|||.|
pombe    69 SVLDKLITTRWKMLPKEQRLGIRNYIVAVMIKNSSDETVLQQQKTFLNKLDLTLVQILKQEWPHN 133

  Fly   143 WETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTLCS 207
            |..||.:||.|||||.|||.|||::|:.||||:||:|..|:||.|.|:||:.||.||::||.|||
pombe   134 WPNFIPEIVQASKTNLSLCENNMIVLRLLSEEIFDYSAEQMTQLKTKNLKNQMCGEFAEIFQLCS 198

  Fly   208 FVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNVTLKCLSEIAGLT 272
            .:||.:...:||..||.|||||||||||||||||..:|.:..:||:||.|||||::||:|||.||
pombe   199 QILERAQKPSLIKATLGTLLRFLNWIPLGYIFETNIVELITNRFLNVPDFRNVTIECLTEIASLT 263

  Fly   273 A-ANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFLKEHGKLVED 336
            : ..|::.|.|:|...|..:..::....:....::..|..||:.:.|||:|||.|...|.:.:|:
pombe   264 SQPQYNDKFVTMFNLVMTSVNSMLPLQTDFREAYEESSTNEQDFIQNLALFLCAFFSSHLRPLEN 328

  Fly   337 AKYVDYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYN-------SEFFHPTLESTKRQQV 394
            .:..:.|..|..||:.||.:.:.|:||||||||:.||..||.       || .:|.|..:....:
pombe   329 PENQEVLLNAHSYLLNISRINEREIFKICLEYWSKLVAQLYEEMQQIPMSE-MNPLLNLSSPTSL 392

  Fly   395 YP-----------RRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLYKN 448
            ..           |:..|..|||.:|.:||..|.||||||:|||:.||:||||:|:|::|.|||:
pombe   393 ISSNPNMLANLPLRKHIYKDILSTLRLVMIENMVKPEEVLIVENDEGEIVREFVKETDTITLYKS 457

  Fly   449 MRETLVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVI 513
            |||.||:|||||.|||:.:||.||...|.|:|:||:|||||||||||||||..||.||||||.||
pombe   458 MREVLVYLTHLDVVDTEIVMTEKLARIVVGTEWSWQNLNTLCWAIGSISGAMNEEMEKRFLVNVI 522

  Fly   514 KDLLGLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACD 578
            ||||||||.|:||||||::|||||||||||||||:|||||||||||||||||||.|:||||||||
pombe   523 KDLLGLCEMKRGKDNKAVVASNIMYVVGQYPRFLKAHWKFLKTVVNKLFEFMHEYHEGVQDMACD 587

  Fly   579 TFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQD 643
            ||||||.||||:||..|..|...||:||:..::....||.|||.||||||.|||||||..:..|:
pombe   588 TFIKIAQKCRRHFVAQQLGETEPFINEIIRNLAKTTEDLTPQQTHTFYEACGYMISAQPQKHLQE 652

  Fly   644 VLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRIYLD 708
            .||...|.||||.|::|:::|::|...|.:...||.|.::||||||||.::|..:..|:.:.|:|
pombe   653 RLIFDLMALPNQAWENIVAQAAQNAQVLGDPQTVKILANVLKTNVAACTSIGSGFYPQIAKNYVD 717

  Fly   709 MLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLL 773
            ||.:||..|..|.:.:...|......|.::.:..:|||.|.|:..::||:.|.:||.:..||.|.
pombe   718 MLGLYKAVSGLISEVVAAQGNIATKTPHVRGLRTIKKEILKLVDAYISRAEDLELVGNTLIPALF 782

  Fly   774 DAILLDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHR 838
            :|:||||.: .||.||:.:||:.:..||::|.:.:|:::|.:.||||.|||:||:|:|.::|:||
pombe   783 EAVLLDYLQ-NVPDARDAEVLNLITTIVNQLSELLTDKIPLVLDAVFGCTLEMISKDFSEYPEHR 846

  Fly   839 LSFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNL-DQHPG 902
            .:|::||:|:|.:||.|.||||..|||||.:|:||:|||..|::.:.|||||.:::.|: ...|.
pombe   847 AAFFQLLRAINLNCFPALLNIPAPQFKLVINSIVWSFKHVSRDIQETGLNILLELINNMASMGPD 911

  Fly   903 AAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNL---GPIP---DN 961
            .:.:|:|||:..:|..|..|:||:.|.:|....::|||.:|.|||:.:|||.|   ...|   :|
pombe   912 VSNAFFQTYYISLLQDILYVLTDSDHKSGFKLQSLILARLFYLVESNQITVPLYDPSQFPQEMNN 976

  Fly   962 MIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYL 1026
            .:|:::|:.:||.:||.||...|::.||..:..|:::...||..|||||||::| .|.|:::|||
pombe   977 QLFLRQYIMNLLVTAFPHLQPIQIQEFVQTVLALNQDSIKFKLALRDFLIQLKE-FGGDNAELYL 1040

  Fly  1027 EEREAALAEEQSNKHQMQRNIPGMLNPHELPEDMQDE 1063
            ||:|..||.:|..:.:....:|||:.|.::| .|::|
pombe  1041 EEKEQELAAQQKAQLEKAMTVPGMIKPVDMP-TMEEE 1076

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 510/1036 (49%)
IBN_N 43..109 CDD:197981 31/66 (47%)
Xpo1 120..265 CDD:285575 88/145 (61%)
CRM1_C 701..1015 CDD:285920 130/321 (40%)
crm1NP_001342911.1 CRM1 1..1052 CDD:227432 519/1051 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2554
Inparanoid 1 1.050 1022 1.000 Inparanoid score I32
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002975
OrthoInspector 1 1.000 T1124960
orthoMCL 1 0.900 OOG5_127698
Panther 1 1.100 LDO PTHR11223
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R13754
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.