DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and xpo6

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_919355.1 Gene:xpo6 ZFINID:ZDB-GENE-030131-5912 Length:1128 Species:Danio rerio

Alignment Length:1231 Identity:209/1232 (17%)
Similarity:416/1232 (34%) Gaps:422/1232 (34%)


  Fly    17 SQKLDINLLDKIVEVVY--TAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYALQI 79
            |::..:..|:.::...:  ....::.|..:.:|.:....|.:|......|..|:|:....|:|.:
Zfish     3 SEEASLRALESLMTEFFHSCTTNDRKREIEELLNSFAGQPGSWRHWLYFLSNSRNEYVMMYSLTV 67

  Fly    80 LEEVIKTRW-KVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKV----YLNKLNMILVHILKREW 139
            .|.::...| .|...::.|          :::....:::.|:.:    ..|||..::|.|.:::|
Zfish    68 FENLVNKMWVGVASEDKAE----------LRSCLPKLLLSQHALLPFFIRNKLCKVIVDIGRQDW 122

  Fly   140 PRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFT 204
            |..:..|.|:.:...: :.||....:|:||..|||:. ..:..::..:...||..:..:...:..
Zfish   123 PMFYHDFFSNTLQLVQ-SPSLASLGLVLLKMTSEELV-CPREDLSVARKDELKKLLLDQIPTVLN 185

  Fly   205 LCSFVLE----------------------------------NSMNAALIHVTLETLLRFLNWIPL 235
            |.:.:||                                  ::.:.||..:.||.|....:||||
Zfish   186 LLTRILETVWDKHSVTVTTPPPSPTSRESGVMLGDSTPMVLDAESGALCLLALECLAHLFSWIPL 250

  Fly   236 GYIFETQQIETLIFKFL-----------------------SVP-------------------MFR 258
            .... |..:...||.|.                       |:|                   ...
Zfish   251 SSSI-TPSLLASIFHFARFGCQQPIKTKPLPTSNGDSAPGSLPANGGGHCRTGQIVGHAERARLG 314

  Fly   259 NVTLKCLSEI--AGLTAANYDENFATLFKDTMVQLEQIVGQNMNMN-HVFKHG-SDTEQELVLNL 319
            .:.:.|::|:  ......:::|....:|:.|...|:::...:.:.| |..|.. .|.::..|...
Zfish   315 VMAMNCINELMCKNCVPVDFEEFLLRMFQQTFYLLQRLTNTHSHTNTHTIKSRLQDLDESYVEKF 379

  Fly   320 AMFLCTFLKEHGKLVE-DAKY--VDYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNSEF 381
            ..||..|:..|.:.:| :|::  |::|  ||::....::... |.:..||:.|:..::.|     
Zfish   380 TDFLRLFVSVHLRRIESNAQFPLVEFL--ALLFKYTFNQPSH-EGYLACLDIWSVFLDYL----- 436

  Fly   382 FHPTLESTKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLY 446
                                   .:|:|    ||:|..:.|                    ||.|
Zfish   437 -----------------------TTKIR----SRLADRDSV--------------------INRY 454

  Fly   447 KNMRETLVFLTHLDSVDTDRIMTLKLLNQV----NGSEFSWKNLNTLCWAIGSISGAFCEEDEKR 507
            |   :.||.|..            ::||::    |.|:....:..||            ::|::.
Zfish   455 K---DALVLLLR------------EVLNRIQFRLNQSQLEELDDETL------------DDDQQT 492

  Fly   508 FLVTVIKDLLGLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVV--------NKLFEF 564
                                              ::.|:||...:.:..|:        :.||..
Zfish   493 ----------------------------------EWQRYLRQSLEVVARVMELLPSQTFSVLFPV 523

  Fly   565 MHETHD---GVQDMACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFY 626
            :.|..|   |:|.     ||..:...||..:|.:.:  |..:...|..:||::     |.|....
Zfish   524 LQEDLDVYLGLQQ-----FIVRSGTSRRLNITAEAD--CRKLHCALRDLSSLL-----QAVGRLA 576

  Fly   627 E-AVGYMISAQVDQ----VQQDVLIERY----------MQLPNQVWDDII--------------- 661
            | ..|.:.:|:.:.    ||:.|.:..|          |.:|:.:..|:|               
Zfish   577 EFFTGDVFTARFNDALAIVQRLVEVSCYGSQISLYDVEMAVPSVLKPDLIDVHAQSLAALQAYSH 641

  Fly   662 ---------SRASKNVDFLKNMTAVKQLGSIL-------KTNVAACKAL-------GHAYVIQLG 703
                     .|......|:..:|:.....|.|       |..::||..|       ...:::.|.
Zfish   642 WLAQFCGEVQRQQDQTQFVDLITSSMAAASPLINGKVPEKLLLSACHLLVSMATTVRPVFLVSLP 706

  Fly   704 RIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETL-NLI-----------SEWVS 756
            .:.    |::.:.:||            :|..|.:..||:....| |::           .:|.:
Zfish   707 AVQ----NIFNLITEN------------HNHRLPQEAHVLVCRALSNMLLLPWPSLPEGEQQWPN 755

  Fly   757 RSNDNQLVMDNFIPPLLDAILLDYQRCKVPSAR---EPKVLSAMAIIVHKLRQHITNEVPKIFDA 818
            ||.::        ..|:.::...|:....|...   ...|:.....::..|...|:.|..|....
Zfish   756 RSANH--------ARLISSLTQQYRLLPRPPNHHHTSKAVIQQTLCVLRDLVDSISGEATKSRQI 812

  Fly   819 VFECTLDMINKNFEDFP---------QHRLSFY-ELLQAVNAHCFKAFLNIPPAQFKLVFDSVVW 873
            .:....:.:..:...||         ...|||: .|.||:......||.           :.::.
Zfish   813 CYHSLQESVQVSLALFPLFIQQPEVTDEMLSFFLTLFQALRVQMGVAFT-----------EQIIQ 866

  Fly   874 AFKHTMRNVADMGLNIL-------------FKMLQNLDQHPGAAQSF---YQTYFTDILMQIFSV 922
            .|. :|.....:.:.||             .|:||.:.|.||  |:|   ..:..:..|.|::.:
Zfish   867 TFL-SMFTREQLAVGILQEGSSGSKVVQKFLKILQVVVQEPG--QTFKPLLPSILSLCLDQVYPI 928

  Fly   923 VTDTSHTAGLPNHAIILAYMFSLV-----ENRKITVNLGPIPDNMIFIQEYVASLLKSAFTHLSD 982
            |.:.|    .|:   :.|.||.|:     :|.:           ..|....::|:.:|....|.:
Zfish   929 VAERS----CPD---VRAEMFELLFQILHQNWR-----------FFFKSSVLSSVQRSGAEELME 975

  Fly   983 NQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYLEEREAALAEEQSNKHQM 1043
            ||.: |...:       |||.:   .||          ..|:::.::..:..|..:.||::
Zfish   976 NQAQ-FTAAM-------QAFGQ---SFL----------QPDIHIFKQNLSYLEVLNTKHKL 1015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 205/1210 (17%)
IBN_N 43..109 CDD:197981 12/67 (18%)
Xpo1 120..265 CDD:285575 38/225 (17%)
CRM1_C 701..1015 CDD:285920 65/360 (18%)
xpo6NP_919355.1 IBN_N 31..97 CDD:197981 12/76 (16%)
Xpo1 105..>198 CDD:285575 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.