DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and Ranbp21

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_001285453.1 Gene:Ranbp21 FlyBaseID:FBgn0031051 Length:1241 Species:Drosophila melanogaster

Alignment Length:1185 Identity:219/1186 (18%)
Similarity:394/1186 (33%) Gaps:348/1186 (29%)


  Fly    17 SQKLDINLLDKIVEVVYTAQGEQLRL-AQSILTTLKEHPEAWTRVDSILEYS--QNQRTKFYALQ 78
            ::.|...|...|..|:.....:|.|| |.......||......:|...|..|  .||:.:.:.||
  Fly     7 TEALAAELASAIDLVMNPMTQQQARLEAYMACERFKEESPMCAQVGLFLASSPQSNQQVRHFGLQ 71

  Fly    79 ILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYL---NKLNMILVHILKREWP 140
            ::|..||.||..:...:    |.|:....||..:..:...:::..|   :.|:.|:|.::|||||
  Fly    72 LIEYTIKYRWNCITHEE----KVYIKDNAIKMLNVGVGPAEDRSLLPTKDALSRIIVEMIKREWP 132

  Fly   141 RNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQT-----KAKHLKDTMCSEFS 200
            :.|...:.::..|....|:.....:::...|.|:|      .:.||     :.|.:...:.:..:
  Fly   133 QQWSDLLPELSQACTKGEAQTELVLLVFLRLVEDV------ALLQTIESNQRRKDMYQALNNNMN 191

  Fly   201 QIF------------------TLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQ-QIET 246
            .||                  .||::...|: ::.::.:.|.||..|:.|:.:.:|..:. ::..
  Fly   192 DIFEFFLRLVEQHVTAFRETTRLCNYTKANA-HSRVVEMVLLTLSGFVEWVSIQHIMSSNGKLMH 255

  Fly   247 LIFKFLSVPMFRNVTLKCLSEIAGLTAANYDEN-FATLFKDT----MVQLEQIVGQNMNMNHVFK 306
            .:...|:...|:....:||::|........:.. ...||.:.    :.|..||            
  Fly   256 FLCILLNDKAFQCNAAECLAQITNRKGQTKERKPLLQLFNEEPLRYIYQASQI------------ 308

  Fly   307 HGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYVDYLNQALMYLVMISEVED-------VEVFKI 364
             .:||...|.:...:   .|||         |.:..||.....||.:...:|       :||...
  Fly   309 -PADTSSTLAVEQHL---NFLK---------KLLQVLNGMAQQLVALWGKDDATQRPVHLEVLLE 360

  Fly   365 CL----------------EYWNSLVEDLYNSEFFH-----PTLESTKRQQV----YPRRRFYAPI 404
            ||                ..|..|::...:|:.|.     |.|..|...::    ||........
  Fly   361 CLLLLVQHPSLGLSHGSALIWQLLLKHEPSSKDFAMVNYIPKLIHTIAPRIVKLPYPASASSPAS 425

  Fly   405 LSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLYK--NMRETLVFLTHLDSVDTDRI 467
            ||...:|.:...::.|..|..          |...|:.:.:::  .:.:.||...:     .::.
  Fly   426 LSTEAYIRLEHDSEEEYALYF----------FRCRTDFLEIFRLATLVQPLVTYGY-----CEQW 475

  Fly   468 MTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIKDLLGLCEQKKGKDNKAII 532
            :..:|.|....::...|:.|..|..:..:   :.|.|.   ||:|:..:|               
  Fly   476 LQQRLRNAQIEADAEVKSGNVSCSVLDPV---YLEWDA---LVSVLDGVL--------------- 519

  Fly   533 ASNIMYVVGQ--YPRFLRAHWKFLK-TVVNKLFEFMHETHDGVQDMACDTFIKIAIKCRRYFVTI 594
             |.|:.|..:  .|..||...:.|| ..:|.|                 |: .|.:.|.......
  Fly   520 -SRILLVAERPSVPAGLRLLEECLKLETINPL-----------------TY-SILLSCISALFVF 565

  Fly   595 QPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVLIERYMQLPNQVWDD 659
            ....||.........||.:  .|.|:.:...:.|:                   .|:.||:: :.
  Fly   566 LSMSACQITATNCVAMSGV--SLLPRVLDKIFRAL-------------------VMKPPNEL-EK 608

  Fly   660 IISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRIYLDMLNVYKITSENIIQAI 724
            :.::::||:.        :...|:|       ..|.|.|.:.|..::           |.|...:
  Fly   609 VQAKSAKNLR--------RHAASLL-------VKLAHKYPLLLLPVF-----------EQINGHV 647

  Fly   725 EVNGVNVNNQPLIKTMHVVKKETLNLIS----------------------EWVSRSNDNQLVMD- 766
            |:.........|.:.|....:|.|.|||                      ||::..:..:..:| 
  Fly   648 ELLLKEPGKHQLCRLMRTTLQEALILISNHFCDFERQTLFIEHIVQDKRTEWLAFGDALKSPLDF 712

  Fly   767 -NFI----PP---------------LLDA---ILLDYQRCKVPS--------------------- 787
             :|:    ||               ||||   :|...:||..|.                     
  Fly   713 MSFVGLDKPPIFAVEGAVTLQNRSRLLDALHVVLGVVKRCTWPDDPERAQRGGFVIGCTELGNPI 777

  Fly   788 AREPKVLSAMAIIVHKLR-QHITNEV--PKIFDAVFE-------------------CTL--DMIN 828
            .|.|.....:.::.|.|. ..:.||:  |:...|:.|                   |.|  |.::
  Fly   778 CRNPATKHIVPLLSHVLSLMRVLNELFAPEALQALSEGYRGIHGMMEHEKKLLMGICALPTDPLD 842

  Fly   829 KNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPA------QFKLVFDSVVWAFKHTMRNVADMGL 887
            ......|.........:..|...|:....:..|:      |...:.|::|......|..|.|..|
  Fly   843 TTIRSEPTAFEKMQTFMMMVTEGCYHLMGSAGPSLGRDLYQLMGLSDAIVTNVFSRMDLVPDYRL 907

  Fly   888 ----NILFKMLQNLDQHPGAAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAII--LAYMFSLV 946
                .:.||..         ..|...:::..:|:.:|      :|.|.|....:.  ..|:.||.
  Fly   908 RPIIRVFFKPF---------VYSCPPSFYDSVLVPLF------AHLAPLMCERLTRRWIYIASLY 957

  Fly   947 ENRKITVNLGPIPD---------NMIFIQEYVASLLKSAFTHLSDNQVKV-FVTGLFNLDENVQA 1001
            |:.::.   |.:.|         |....:||: .:||.|   |...|:.. .|....|.:.|..|
  Fly   958 ESGQLD---GEVNDTQEVLEDQLNRTLTREYL-DVLKIA---LVGGQIGADHVAAGANANSNSVA 1015

  Fly  1002 F--KEHLRDFLIQIR 1014
            .  :||..|...|.|
  Fly  1016 MENEEHSMDSAPQSR 1030

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 219/1186 (18%)
IBN_N 43..109 CDD:197981 18/68 (26%)
Xpo1 120..265 CDD:285575 32/172 (19%)
CRM1_C 701..1015 CDD:285920 79/430 (18%)
Ranbp21NP_001285453.1 IBN_N 34..101 CDD:281761 19/71 (27%)
Xpo1 116..274 CDD:285575 31/165 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C26047843
eggNOG 1 0.900 E1_COG5101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D40069at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11223
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.