DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and Xpo6

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_001011935.2 Gene:Xpo6 RGDID:1311491 Length:1125 Species:Rattus norvegicus

Alignment Length:1259 Identity:223/1260 (18%)
Similarity:420/1260 (33%) Gaps:366/1260 (29%)


  Fly    17 SQKLDINLLDKIVEVVY--TAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYALQI 79
            |:...:..|:.::...:  ....|:.|..:.:|....:...||......|..::|.....|:|.:
  Rat     3 SEDASLRALESLMTEFFHDCTTNERKREIEELLNNFAQQVGAWRFCLYFLSSTRNDYVMMYSLTV 67

  Fly    80 LEEVIKTRWKVLPRNQCEGIKKYVVSLII---KTSSDPIVMEQNKVYLNKLNMILVHILKREWPR 141
            .|.:|...|..:|......|:..:..|::   ||.  |..:.      |||..::|.|.:::||.
  Rat    68 FENLINKMWLGVPSQDKMEIRSCLPKLLLAHHKTL--PYFIR------NKLCKVIVDIGRQDWPM 124

  Fly   142 NWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTLC 206
            .:..|.::|:...::..:..: .:::||..|||: ...:..::..:.:.|:..:..:...:..|.
  Rat   125 FYHDFFTNILQLIQSPVTTPL-GLIMLKTTSEEL-ACPREDLSVARKEELRKLLLDQVQTVLGLL 187

  Fly   207 SFVLE-----NSMNAA--------------------------LIH---------------VTLET 225
            :.:||     :|:.||                          |:|               :.||.
  Rat   188 TGILETVWDKHSVTAATPPPSPTSGESGDLLSNLLQSPSSAKLLHQPIPILDVESEYVCSLALEC 252

  Fly   226 LLRFLNWIPLGYIFETQQIETLIFKF------------------------------LSVPMFRNV 260
            |....:||||.... |..:.|.||.|                              |.|     :
  Rat   253 LAHLFSWIPLSASI-TPSLLTTIFHFARFGCDTRARKMASVNGSSQNCVLGQERGRLGV-----L 311

  Fly   261 TLKCLSEIAGLTAA--NYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFL 323
            .:.|::|:......  .::|....:|:.|...|::|...| |.:.|.....:.::..|.....||
  Rat   312 AMSCINELMSKNCVPMEFEEYLLRMFQQTFYLLQKITKDN-NAHTVKSRLEELDESYVEKFTDFL 375

  Fly   324 CTFLKEHGKLVEDAKYVDYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNSEFFHPTLES 388
            ..|:..|.:.:|.......|....:...........|.:..||:.|...::.|            
  Rat   376 RLFVSVHLRRIESYSQFPVLEFLTLLFKYTFHQPTHEGYFSCLDIWTLFLDYL------------ 428

  Fly   389 TKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEV----------LVVENEN-----------GEV 432
                            .||::    ||:...|.|          |:.|..|           .|:
  Rat   429 ----------------TSKIK----SRLGDKEAVLNRYEDALVLLLTEVLNRIQFRYNQAQLEEL 473

  Fly   433 VREFMKDTNSINLYKNMRETL-VFLTHLDSVDTDRIMTLKLLNQVN--------------GS--- 479
            ..|.:.|.......:.:|::| |....::.:.|....||..:.|.|              ||   
  Rat   474 DDETLDDDQQTEWQRYLRQSLEVVAKVMELLPTHAFSTLFPVLQDNLEVYLGLQQFVVTSGSGHR 538

  Fly   480 ------------EFSWKNLNTLCWAIGSISGAFC-EEDEKRF--LVTVIKDLLGLCEQKKGKDNK 529
                        ..|.::|::|..|:|.::..|. :....||  .:||::.|:.:  ...|...|
  Rat   539 LNITAENDCRRLHCSLRDLSSLLQAVGRLAEYFTGDVFAARFSDALTVVERLVKV--TLYGSQIK 601

  Fly   530 ---------AIIASNIMYVVGQYPRFLRA--HWKFLKTVVNKLFEFMHETH-DGVQDMACDTFIK 582
                     :::..:::.|..|....|:|  ||         |.::..|.| ...|...  |.|.
  Rat   602 LYNIETAVPSVLKPDLIDVHAQSLAALQAYSHW---------LAQYCSEAHRQNTQQFV--TLIS 655

  Fly   583 IAIKCRRYFVTIQPNE-----ACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQ- 641
            ..:......::.:..:     ||..:..:.||:..:.....|.....|...:........|:.| 
  Rat   656 TTMDAITPLISTKVQDKLLLSACHLLVSLATTVRPVFLISIPAMQKVFNSIIDASAQRLTDKAQV 720

  Fly   642 ------QDVLIERYMQLP--NQVWD-------DIISRASKNVDFLKNMTAVKQLGSILKTNVAAC 691
                  .:.|:..:..||  .|.|.       .:||..|::...||...|..|    .|..:...
  Rat   721 LVCRALSNTLLLPWPNLPESEQQWPLRSINHASLISALSRDYHSLKPSAAAPQ----RKMPLDDT 781

  Fly   692 KALGHAYVIQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNN-----QPLIKTMHVVKKETLNLI 751
            |.:.|           ..|:|::...|||      :|.:..:     |.|.:::.|    :|.|.
  Rat   782 KVIIH-----------QTLSVFEDIVENI------SGESTKSRQICYQSLQESVQV----SLALF 825

  Fly   752 SEWVSRSNDNQLVMDNFIP-----------PLLDAILLDYQR------------------CKVPS 787
            ..::.:|:....::..|:.           |..:.|:..:..                  |:|..
  Rat   826 PAFIHQSDVTDEMLSFFLTLFRGLRVQMGVPFTEQIIQTFLNMFTREQLAESILHEGSTGCRVVE 890

  Fly   788 AREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFYELLQAVNAHC 852
                |.|..:.::|.:..|.....:|.|.....|....:|.:  ...|..:...:|||.....|.
  Rat   891 ----KFLKILQVVVQEPGQVFKPFLPSIIALCMEQVYPIIAE--RPSPDVKAELFELLFRTLHHN 949

  Fly   853 FKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLDQHPGAAQSFYQTYF-TDIL 916
            ::.|           |.|.|.|  ...|.:|:       :.::|..|.....|:|.|::. .|| 
  Rat   950 WRYF-----------FKSTVLA--SVQRGIAE-------EQMENEPQFSAIMQAFGQSFLQPDI- 993

  Fly   917 MQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNLGPIPDNMIFIQEYVASLLKSAFTH-- 979
             .:|.           .|    |.|:.:|...:|: .:.......|:|  ::|..||: ...|  
  Rat   994 -HLFK-----------QN----LFYLETLNTKQKL-YHKKIFRTTMLF--QFVNVLLQ-VLVHKS 1038

  Fly   980 --LSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYLEEREAALAEEQSN--- 1039
              |...::.:.:..:.::|.: ..|...|.:||      |..|..|           ..|.|   
  Rat  1039 HDLLQEEIGIAIYNMASVDFD-GFFAAFLPEFL------TSCDGVD-----------ANQKNVLG 1085

  Fly  1040 -KHQMQRNIPGML-NPHELPEDMQ 1061
             ..:|.|::|... |.|.|..|::
  Rat  1086 RNFKMDRDLPSFTQNVHRLVNDLR 1109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 213/1215 (18%)
IBN_N 43..109 CDD:197981 13/69 (19%)
Xpo1 120..265 CDD:285575 38/221 (17%)
CRM1_C 701..1015 CDD:285920 62/353 (18%)
Xpo6NP_001011935.2 IBN_N 31..96 CDD:197981 13/65 (20%)
Xpo1 103..277 CDD:285575 35/183 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.