DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and XPO6

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_055986.1 Gene:XPO6 HGNCID:19733 Length:1125 Species:Homo sapiens

Alignment Length:1305 Identity:231/1306 (18%)
Similarity:427/1306 (33%) Gaps:458/1306 (35%)


  Fly    17 SQKLDINLLDKIVEVVY--TAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYALQI 79
            |::..:..|:.::...:  ....|:.|..:.:|....:...||......|..::|.....|:|.:
Human     3 SEEASLRALESLMTEFFHDCTTNERKREIEELLNNFAQQIGAWRFCLYFLSSTRNDYVMMYSLTV 67

  Fly    80 LEEVIKTRWKVLPRNQCEGIKKYVVSLII---KTSSDPIVMEQNKVYLNKLNMILVHILKREWPR 141
            .|.:|...|..:|......|:..:..|::   ||.  |..:.      |||..::|.|.:::||.
Human    68 FENLINKMWLGVPSQDKMEIRSCLPKLLLAHHKTL--PYFIR------NKLCKVIVDIGRQDWPM 124

  Fly   142 NWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTLC 206
            .:..|.::|:...::..:..: .:::||..|||: ...:..::..:.:.|:..:..:...:..|.
Human   125 FYHDFFTNILQLIQSPVTTPL-GLIMLKTTSEEL-ACPREDLSVARKEELRKLLLDQVQTVLGLL 187

  Fly   207 SFVLE-----NSMNAA-----------------------------------------LIHVTLET 225
            :.:||     :|:.||                                         :..:.||.
Human   188 TGILETVWDKHSVTAATPPPSPTSGESGDLLSNLLQSPSSAKLLNQPIPILDVESEYICSLALEC 252

  Fly   226 LLRFLNWIPLGYIFETQQIETLIFKF------------------------------LSVPMFRNV 260
            |....:||||.... |..:.|.||.|                              |.|     :
Human   253 LAHLFSWIPLSASI-TPSLLTTIFHFARFGCDIRARKMASVNGSSQNCVSGQERGRLGV-----L 311

  Fly   261 TLKCLSEIAGLTAA--NYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFL 323
            .:.|::|:......  .::|....:|:.|...|::|...| |.:.|.....:.::..:.....||
Human   312 AMSCINELMSKNCVPMEFEEYLLRMFQQTFYLLQKITKDN-NAHTVKSRLEELDESYIEKFTDFL 375

  Fly   324 CTFLKEHGKLVEDAK---YVDYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNSEFFHPT 385
            ..|:..|.:.:|...   .|::|.....|..   .....|.:..||:.|...::.|         
Human   376 RLFVSVHLRRIESYSQFPVVEFLTLLFKYTF---HQPTHEGYFSCLDIWTLFLDYL--------- 428

  Fly   386 LESTKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEV----------LVVENEN----------- 429
                               .||::    ||:...|.|          |:.|..|           
Human   429 -------------------TSKIK----SRLGDKEAVLNRYEDALVLLLTEVLNRIQFRYNQAQL 470

  Fly   430 GEVVREFMKDTNSINLYKNMRETL-VFLTHLDSVDTDRIMTLKLLNQVN--------------GS 479
            .|:..|.:.|.......:.:|::| |....::.:.|....||..:.|.|              ||
Human   471 EELDDETLDDDQQTEWQRYLRQSLEVVAKVMELLPTHAFSTLFPVLQDNLEVYLGLQQFIVTSGS 535

  Fly   480 ---------------EFSWKNLNTLCWAIGSISGAFC-EEDEKRF--LVTVIKDLLGLCEQKKGK 526
                           ..|.::|::|..|:|.::..|. :....||  .:||::.|:.:  ...|.
Human   536 GHRLNITAENDCRRLHCSLRDLSSLLQAVGRLAEYFIGDVFAARFNDALTVVERLVKV--TLYGS 598

  Fly   527 DNK---------AIIASNIMYVVGQYPRFLRA--HWKFLKTVVNKLFEFMHETHDGVQDMACDTF 580
            ..|         :::..:::.|..|....|:|  ||         |.::..|.|.          
Human   599 QIKLYNIETAVPSVLKPDLIDVHAQSLAALQAYSHW---------LAQYCSEVHR---------- 644

  Fly   581 IKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVL 645
                 :..:.|||:           |.|||                :|:..:||.:|    ||.|
Human   645 -----QNTQQFVTL-----------ISTTM----------------DAITPLISTKV----QDKL 673

  Fly   646 IERYMQLPNQVWDDIISRASK-NVDFLKNMTAVKQ----------LGSILKTNVAACKALGHAYV 699
            :.....|       ::|.|:. ...||.::.||::          |..:.|..|..|:||.    
Human   674 LLSACHL-------LVSLATTVRPVFLISIPAVQKVFNRITDASALRLVDKAQVLVCRALS---- 727

  Fly   700 IQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLV 764
                       |:..:...|:.:         |.|                  :|..||.::   
Human   728 -----------NILLLPWPNLPE---------NEQ------------------QWPVRSINH--- 751

  Fly   765 MDNFIPPLLDAILLDYQRCKVPSAREPK---VLSAMAIIVHK-------LRQHITNEVPKIFDAV 819
                 ..|:.|:..||:..| |||..|:   .|....:|:|:       :.::|:.|..|.....
Human   752 -----ASLISALSRDYRNLK-PSAVAPQRKMPLDDTKLIIHQTLSVLEDIVENISGESTKSRQIC 810

  Fly   820 FECTLDMINKNFEDFP---------QHRLSFYELLQAVNAHCFKAF---LNIPPAQFKLVFDSVV 872
            ::...:.:..:...||         ...|||:..|       |:..   :.:|      ..:.::
Human   811 YQSLQESVQVSLALFPAFIHQSDVTDEMLSFFLTL-------FRGLRVQMGVP------FTEQII 862

  Fly   873 WAFKH--TMRNVAD-------MGLNIL---FKMLQNLDQHPG----------AAQSFYQTY---- 911
            ..|.:  |...:|:       .|..::   .|:||.:.|.||          .|....|.|    
Human   863 QTFLNMFTREQLAESILHEGSTGCRVVEKFLKILQVVVQEPGQVFKPFLPSIIALCMEQVYPIIA 927

  Fly   912 ---FTDILMQIFSVVTDTSH---------------TAGLPNH---------AIILAYMFSLVENR 949
               ..|:..::|.::..|.|               ..|:...         ||:.|:..|.::  
Human   928 ERPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFSAIMQAFGQSFLQ-- 990

  Fly   950 KITVNLGPIPDNMIFIQE--YVASL-LKSAFTHLSDNQVKVFVTGLF----NLDENVQAFKEHLR 1007
                     ||..:|.|.  |:.:| .|....|     .|:|.|.:.    |:...|...|.|  
Human   991 ---------PDIHLFKQNLFYLETLNTKQKLYH-----KKIFRTAMLFQFVNVLLQVLVHKSH-- 1039

  Fly  1008 DFL-----IQIREATGEDDSDL-------YLEEREAALAEEQS---NKHQMQRNIPGML-NPHEL 1056
            |.|     |.|......|....       :|...:...|.::|   ...:|.|::|... |.|.|
Human  1040 DLLQEEIGIAIYNMASVDFDGFFAAFLPEFLTSCDGVDANQKSVLGRNFKMDRDLPSFTQNVHRL 1104

  Fly  1057 PEDMQ 1061
            ..|::
Human  1105 VNDLR 1109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 221/1255 (18%)
IBN_N 43..109 CDD:197981 13/69 (19%)
Xpo1 120..265 CDD:285575 36/221 (16%)
CRM1_C 701..1015 CDD:285920 71/401 (18%)
XPO6NP_055986.1 IBN_N 31..96 CDD:197981 13/65 (20%)
Xpo1 103..277 CDD:312035 33/183 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.