DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and xpo-1

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_741567.1 Gene:xpo-1 WormBaseID:WBGene00002078 Length:1080 Species:Caenorhabditis elegans

Alignment Length:1086 Identity:538/1087 (49%)
Similarity:762/1087 (70%) Gaps:33/1087 (3%)


  Fly     1 MATMLTSDEAGKLLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAWTRVDSILE 65
            ::.|....||.:......::|:.|||::||::....|::...|..||.:|||..::||:||:||:
 Worm     3 VSAMEVLSEAKRQFAQGDRIDVTLLDQVVEIMNRMSGKEQAEANQILMSLKEERDSWTKVDAILQ 67

  Fly    66 YSQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMI 130
            |||...:|::||||||.||:.:||.||:.|.||||.|:::.:.:.|||..||||:::.|:|||::
 Worm    68 YSQLNESKYFALQILETVIQHKWKSLPQVQREGIKSYIITKMFELSSDQSVMEQSQLLLHKLNLV 132

  Fly   131 LVHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTM 195
            ||.|:|::||:.|.|||:|||.:||.||::|:|||.||..||||||||....:||.|.:|||...
 Worm   133 LVQIVKQDWPKAWPTFITDIVDSSKNNETVCINNMNILSLLSEEVFDFGSQNLTQAKEQHLKQQF 197

  Fly   196 CSEFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNV 260
            |.:|.::||||..:||...:.:::..||:||.|||.|||:||:|||...|.|...|||:.::|.:
 Worm   198 CGQFQEVFTLCVSILEKCPSNSMVQATLKTLQRFLTWIPVGYVFETNITELLSENFLSLEVYRVI 262

  Fly   261 TLKCLSEIAGLTA----ANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAM 321
            .|:||:||:.:..    .:|||....:|..||..:.|::..::::..|:|..||.:|:|:.:||.
 Worm   263 ALQCLTEISQIQVETNDPSYDEKLVKMFCSTMRHISQVLSLDLDLAAVYKDASDQDQKLISSLAQ 327

  Fly   322 FLCTFLKEHGKLVE-------DAKYV-----DYLNQALMYLVMISEVEDVEVFKICLEYWNSLVE 374
            ||..|:|||..|:|       :||.:     ||   |:..|:.|:.:|::||||:||:.|..|..
 Worm   328 FLVAFIKEHVHLIEVTDEPLTEAKILMRESHDY---AIQLLLKITLIEEMEVFKVCLDCWCWLTA 389

  Fly   375 DLYN-SEFFHPTLESTKRQQV--YPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREF 436
            :||. ..|..|:.......||  :|||:.|...||::|..||||||||||||:|||:.||||||.
 Worm   390 ELYRICPFIQPSTLYGMMSQVREHPRRQLYREYLSQLRSTMISRMAKPEEVLIVENDQGEVVREM 454

  Fly   437 MKDTNSINLYKNMRETLVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFC 501
            :|||:||.||:|||||||:|||||:.||:..||.||.:||||.||||||||.||||:|||||...
 Worm   455 VKDTDSIALYRNMRETLVYLTHLDNKDTEVKMTEKLASQVNGGEFSWKNLNRLCWAVGSISGTMV 519

  Fly   502 EEDEKRFLVTVIKDLLGLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMH 566
            |||||||||.||:|||||||||:||||||:||||||||||||||||||||||||||:||||||||
 Worm   520 EEDEKRFLVLVIRDLLGLCEQKRGKDNKAVIASNIMYVVGQYPRFLRAHWKFLKTVINKLFEFMH 584

  Fly   567 ETHDGVQDMACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGY 631
            |||:|||||||||||||:|||:|:||.:||.|...|::|:|..::.|||||...|||.||||||:
 Worm   585 ETHEGVQDMACDTFIKISIKCKRHFVIVQPAENKPFVEEMLENLTGIICDLSHAQVHVFYEAVGH 649

  Fly   632 MISAQVDQVQQDVLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGH 696
            :||||:|...|:.||.:.|.:||:.|:|||:.||.|...|:....||.:.:||||||||||::|.
 Worm   650 IISAQIDGNLQEDLIMKLMDIPNRTWNDIIAAASTNDSVLEEPEMVKSVLNILKTNVAACKSIGS 714

  Fly   697 AYVIQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDN 761
            ::|.|||.||.|:|::|||.||.:.:|:...|......||:|||..||:|.|.|:|.::|::.|.
 Worm   715 SFVTQLGNIYSDLLSLYKILSEKVSRAVTTAGEEALKNPLVKTMRAVKREILILLSTFISKNGDA 779

  Fly   762 QLVMDNFIPPLLDAILLDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDM 826
            :|::|:.:|||.||:|.|||: .||.||||||||.::|:|.:|...:..:||.|..|||:|::||
 Worm   780 KLILDSIVPPLFDAVLFDYQK-NVPQAREPKVLSLLSILVTQLGSLLCPQVPSILSAVFQCSIDM 843

  Fly   827 INKNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILF 891
            |||:.|.||:||.:|:||:.::...||..|:.:||.....|.|:|||||:|||||||::||:||.
 Worm   844 INKDMEAFPEHRTNFFELVLSLVQECFPVFMEMPPEDLGTVIDAVVWAFQHTMRNVAEIGLDILK 908

  Fly   892 KMLQNL-DQHPGAAQSFYQTYFTDILMQIFSVVTDTS--HTAGLPNHAIILAYMFSLVE-NRKIT 952
            ::|..: :|....||.||:.|:.|:|..:.:|..|:|  |.|||..:|.:|..:|...| :.|:.
 Worm   909 ELLARVSEQDDKIAQPFYKRYYIDLLKHVLAVACDSSQVHVAGLTYYAEVLCALFRAPEFSIKVP 973

  Fly   953 VN-LGPIPDNMIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREA 1016
            :| ..|...|:.:|.|::....::.|.:::.:|:::.:.|.|:.:..:.:.:.|||||||||:|.
 Worm   974 LNDANPSQPNIDYIYEHIGGNFQAHFDNMNQDQIRIIIKGFFSFNTEISSMRNHLRDFLIQIKEH 1038

  Fly  1017 TGEDDSDLYLEEREAALAEEQSNKHQMQRNIPGMLNPHEL-PEDMQ 1061
            .|||.||||||||||.:.:.|    |.:|::||:|.|.|: .|||:
 Worm  1039 NGEDTSDLYLEEREAEIQQAQ----QRKRDVPGILKPDEVEDEDMR 1080

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 515/1034 (50%)
IBN_N 43..109 CDD:197981 34/66 (52%)
Xpo1 120..265 CDD:285575 72/145 (50%)
CRM1_C 701..1015 CDD:285920 133/319 (42%)
xpo-1NP_741567.1 CRM1 22..1062 CDD:227432 526/1048 (50%)
IBN_N 45..109 CDD:281761 34/64 (53%)
Xpo1 134..267 CDD:285575 67/133 (50%)
CRM1_C 719..1039 CDD:285920 134/321 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25692104
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H2554
Inparanoid 1 1.050 1054 1.000 Inparanoid score I133
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D132850at2759
OrthoFinder 1 1.000 FOG0002975
OrthoInspector 1 1.000 T477260
orthoMCL 1 0.900 OOG5_127698
Panther 1 1.100 LDO PTHR11223
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R13754
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.