DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and Xpo1

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_001030303.1 Gene:Xpo1 MGIID:2144013 Length:1071 Species:Mus musculus

Alignment Length:1067 Identity:758/1068 (71%)
Similarity:888/1068 (83%) Gaps:8/1068 (1%)


  Fly     3 TMLTSDEAGKLLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYS 67
            |||....|.:||||||||||||||.:|..:|..:|.|.|:||.:||.|||||:||||||:|||:|
Mouse     6 TMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFS 70

  Fly    68 QNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILV 132
            ||..||:|.|||||.|||||||:||||||||||||||.|||||||||..:|:.|||:.|||||||
Mouse    71 QNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILV 135

  Fly   133 HILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCS 197
            .|||:|||::|.||||||||||:|:||||.|||||||.|||||||||.|||||.|||||||:||:
Mouse   136 QILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCN 200

  Fly   198 EFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNVTL 262
            ||||||.||.||:|||.||.|:|.||||||||||||||||||||:.|.|||:|||:|||||||:|
Mouse   201 EFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSL 265

  Fly   263 KCLSEIAGLTAANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFL 327
            |||:||||::.:.|:|.|.|||..||:||:|::..|.|:...:.:|.|.||..:.||::||||||
Mouse   266 KCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFL 330

  Fly   328 KEHGKLVEDAKYV-DYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNSEFF----HPTLE 387
            ||||:|:|....: :.|.:||.|::::||||:.|:|||||||||.|..:||....|    .|.|.
Mouse   331 KEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLS 395

  Fly   388 STKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLYKNMRET 452
            .::...:.|||:.|..:|||||.:|:||||||||||||||:.|||||||||||:|||||||||||
Mouse   396 GSQHFDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRET 460

  Fly   453 LVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIKDLL 517
            ||:|||||.|||:.|||.||.|||||:|:||||||||||||||||||..||||||||||||||||
Mouse   461 LVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLL 525

  Fly   518 GLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIK 582
            ||||||:||||||||||||||:|||||||||||||||||||||||||||||||||||||||||||
Mouse   526 GLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIK 590

  Fly   583 IAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVLIE 647
            ||.||||:||.:|..|...||||||..:::|||||||||||||||||||||.||.||..|:.|||
Mouse   591 IAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIE 655

  Fly   648 RYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRIYLDMLNV 712
            :||.|||||||.||.:|:||||.||:...||||||||||||.||||:||.:||||||||||||||
Mouse   656 KYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV 720

  Fly   713 YKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLLDAIL 777
            ||..||||..||:.||..|..||||::|..||:|||.|||.|||||||.|:|.:||:||||||:|
Mouse   721 YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVL 785

  Fly   778 LDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFY 842
            :|||| .||:||||:|||.|||||:||..|||.|:|:||||||||||:||||:||::|:||.:|:
Mouse   786 IDYQR-NVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFF 849

  Fly   843 ELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLDQHPGAAQSF 907
            .||||||:|||.|||.|||||||||.||::||||||||||||.||.|||.:|||:.|...|||||
Mouse   850 LLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSF 914

  Fly   908 YQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNLGP--IPDNMIFIQEYVA 970
            |||||.|||..||||||||||||||..||.||||||:|||..||:..|.|  ..:|.:|||:|||
Mouse   915 YQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNPGNPVNNQMFIQDYVA 979

  Fly   971 SLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYLEEREAALAE 1035
            :||||||.||.|.|||:||||||:|::::.||||||||||:||:|..|||.|||:|||||.||.:
Mouse   980 NLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQ 1044

  Fly  1036 EQSNKHQMQRNIPGMLNPHELPEDMQD 1062
            .|..||::|.::||:|||||:||:|.|
Mouse  1045 AQEEKHKLQMSVPGILNPHEIPEEMCD 1071

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 730/1017 (72%)
IBN_N 43..109 CDD:197981 53/66 (80%)
Xpo1 120..265 CDD:285575 116/145 (80%)
CRM1_C 701..1015 CDD:285920 223/316 (71%)
Xpo1NP_001030303.1 CRM1 15..1044 CDD:227432 739/1030 (72%)
HEAT 1 217..240 19/23 (83%)
HEAT 2 241..277 26/36 (72%)
Necessary for interaction with Ran and nuclear export complex formation. {ECO:0000250} 327..450 69/123 (56%)
HEAT 3 354..472 75/118 (64%)
Necessary for interaction with RANBP3. {ECO:0000250} 411..481 57/70 (81%)
HEAT 4 515..553 36/38 (95%)
HEAT 5 560..597 36/37 (97%)
HEAT 6 602..639 26/37 (70%)
HEAT 7 775..813 29/39 (74%)
HEAT 8 885..916 22/31 (71%)
HEAT 9 917..954 30/37 (81%)
HEAT 10 1002..1039 25/37 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25518822
eggNOG 1 0.900 E1_COG5101
Hieranoid 1 1.000
Homologene 1 1.000 H2554
Inparanoid 1 1.050 1525 1.000 Inparanoid score I98
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002975
OrthoInspector 1 1.000 T1083590
orthoMCL 1 0.900 OOG5_127698
Panther 1 1.100 LDO PTHR11223
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R13754
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.