DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and exd3

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_017951842.1 Gene:exd3 XenbaseID:XB-GENE-6046956 Length:589 Species:Xenopus tropicalis

Alignment Length:362 Identity:68/363 (19%)
Similarity:109/363 (30%) Gaps:142/363 (39%)


  Fly   822 CT-------LDMINKNFEDFPQHRLSFYELLQAVNAHCFKA------FLNIPPAQFKLVFDSVVW 873
            ||       .:::.....|:.:.:....::|...:|..|.|      ::.:||          |.
 Frog     2 CTPLLFMERFNLVEAYVADYRELQCRLVQMLDGWSASNFNARKVSRQYIGLPP----------VK 56

  Fly   874 AFKHTMRNVADMGLNILFKMLQNLDQHPGAAQSFY---------QTYFTDILM------------ 917
            ..|..|:.::    .:.||:|:..:..||.:...|         ...|..|||            
 Frog    57 PDKLNMKTLS----RLAFKLLERYNLDPGTSPWVYLYLYIWVGGAIVFPYILMLPVALQSTVGQS 117

  Fly   918 -----QIFSVVTDTSHTA---------GLPNHAIILAYMFSLVENRKITVNLG------------ 956
                 |:.:::...|..|         |||...:.||...|| |:..|...|.            
 Frog   118 RWLQDQLITLLVRYSDCATAGRWALHFGLPKETLPLAVADSL-EDLSIQDQLSANENVPDDPQTR 181

  Fly   957 -------PIPDNMIFIQEYVASLLKSAFTHLSDNQV----------------------------K 986
                   |||.:.|........|.......|.|.||                            :
 Frog   182 KEHFYQLPIPRDKIHFLRSAGDLSVCRERVLKDGQVVGVDMEWRPMFGGLGKQTVSLVQLALREE 246

  Fly   987 VFVTGLFNLD------ENVQAFKEHLRDFL-------------------IQIREATGEDDSDLYL 1026
            ||:..|..|:      ...|..:|.|..|:                   ||..|||  |...|.|
 Frog   247 VFLLDLLQLNAPGAGANGTQRTREELIRFIKDLFLCAAITKLSYSVLGDIQNLEAT--DPEFLGL 309

  Fly  1027 EEREAALAEEQSNKHQMQRNIP----GMLNPHELPED 1059
            |::...:.:..:...|:|| :|    |...|.::..|
 Frog   310 EKQTRGILDLYTVHKQLQR-VPHRPRGKREPVDVLAD 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 58/321 (18%)
IBN_N 43..109 CDD:197981
Xpo1 120..265 CDD:285575
CRM1_C 701..1015 CDD:285920 54/313 (17%)
exd3XP_017951842.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.