DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and xpo6

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_004918081.1 Gene:xpo6 XenbaseID:XB-GENE-493618 Length:1139 Species:Xenopus tropicalis

Alignment Length:1192 Identity:211/1193 (18%)
Similarity:426/1193 (36%) Gaps:333/1193 (28%)


  Fly    17 SQKLDINLLDKIVEVVY--TAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYALQI 79
            |::..:..|:.::...:  ....|:.|..:|:|....:...||......|..|.|.....|:|.:
 Frog     3 SEEASLRALESLMSEFFHNGTSNERKREIESLLNNFAQQLGAWRFCFYFLSQSHNDYVLMYSLSV 67

  Fly    80 LEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKV----YLNKLNMILVHILKREWP 140
            .|.:|...|..:|..:         .:.|::|...:::.|:|.    ..|||..::|.:.:::||
 Frog    68 FENLINKMWLGVPSQE---------KMEIRSSLPKLLLSQHKTLPSFICNKLCKVIVDMGRQDWP 123

  Fly   141 RNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTL 205
            ..:..|.::|:...:|..:..: .:::||..|||: ...:..::..:.:.|:..:..:...:..|
 Frog   124 MFYHDFFTNILQLIQTPSTTPL-GLIMLKTASEEL-ACPREDLSVARKEELRKLLLEQVPTVLGL 186

  Fly   206 CSFVLE-----NSMNAA-----------------LIH------------------------VTLE 224
            .:.|||     :|:.||                 |||                        :.||
 Frog   187 LTGVLESIWDKHSITAATPPPSPTASDTDDLLSNLIHTPNLTKQLSQPPPSLEAESERVCALALE 251

  Fly   225 TLLRFLNWIPLGYIFETQQIETLIFKFL--------------------------SVPMFRN---- 259
            .|....:||||.... |..:.|.||.|.                          |.|...:    
 Frog   252 CLSHLFSWIPLSASI-TPTLLTTIFHFARLGCDARSRHTSSITTNTTCVVNGGSSSPPLSSAAHS 315

  Fly   260 ----------VTLKCLSEI--AGLTAANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTE 312
                      :.:.|::|:  .......:.|....:.:.|...|::|. :..|.:.|.....:.:
 Frog   316 SQRDRGRLGVLAMSCINELMCKNCVPLEFQEYLLRVCQQTFYLLQRIT-RETNAHSVRTRLEELD 379

  Fly   313 QELVLNLAMFLCTFLKEHGKLVE-DAKY--VDYLNQALMYLVMISEVEDVEVFKICLEYWNSLVE 374
            :..|.....||..|:..|.:.:| :|::  |::|  ||::.....:... |.:..||:.|...::
 Frog   380 ESYVEKFTDFLRLFVSVHLRRIESNAQFPVVEFL--ALLFKYTFHQPTH-EGYLSCLDIWALFLD 441

  Fly   375 DLYNSEFFHPTLESTKRQQVYPRRR-----FYAPILSKVRFIMISRMAK--PEEVLVVENENG-- 430
            .|.|.  ....||.  |:.:..|..     ....:|::::|.......:  .:|.|..:.:..  
 Frog   442 YLTNK--IRNRLED--REAIIGRYEDALVLLLTEVLNRIQFRYNQTQLEELDDETLDDDQQTEWQ 502

  Fly   431 -------EVVREFMK--DTNSIN-LYKNMRETL-VFL---THLDSVDTDRIMTLKLLNQVNGSEF 481
                   |||.:.|:  .|::.: |:..::|.| |:|   ..|.:...|:.:.:...|.......
 Frog   503 RYLRHSLEVVAKIMELLPTHAFSTLFSALQENLDVYLGLQRCLVTNGNDQRLNVTAENDCRRLHC 567

  Fly   482 SWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIKDLLGLCEQKKGKDNKAIIASNIMYVVGQYPRF 546
            |.::|::|..|:|.::..|            |.|:.|      .:.|.|:.....:..|..|...
 Frog   568 SLRDLSSLLQAVGRLAEYF------------IGDVFG------ARFNDALTVVERLVEVTLYGSQ 614

  Fly   547 LRAHWKFLKTVVNKLFE-FMHETHDGVQDMACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTM 610
            ::.:  .::|.|..:.: .:.:.|  .|.:|........:.|  |:..:|......||..|.|.|
 Frog   615 IKLY--NMETAVPSVLKPDLIDVH--AQSLAALQAYSHWLAC--YYSEVQRQNPEQFISIISTAM 673

  Fly   611 SSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVLIERYMQLPNQVWDDIISRASKNVDFLKNMT 675
                            ||:..:||:   :||:.:|:.....|.:      ::...:.| ||.|:.
 Frog   674 ----------------EALPPLISS---KVQEKLLLSACHLLVS------VATTVRPV-FLINIP 712

  Fly   676 AVKQLGSIL----------KTNVAACKALGHAYVIQLGRIYLDMLNVYKITSENIIQAIEVNGVN 730
            ||:::.|.:          :..|..|:||.               ||..:...|:.:..:     
 Frog   713 AVQKVFSRVTDSSAQRLPEEAQVLLCRALS---------------NVLLLPWPNVPEGEQ----- 757

  Fly   731 VNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCK--VPSAREPKV 793
                                  :|..||:.:        ..||:|:..||:..|  .|..|:.::
 Frog   758 ----------------------QWGERSSHH--------ANLLNALTRDYRLLKGSSPPQRKGQL 792

  Fly   794 LSAMAIIVHKLR------QHITNEVPKIFDAVFECTLDMINKNFEDFP---------QHRLSFY- 842
            .:...:|...|.      ::|:.|..|.....::...:....:...||         :..|||: 
 Frog   793 EATKRVICQTLGVLRDIVENISGEGTKSRQICYQSLQESAQLSLALFPAYIHQSDVTEEMLSFFL 857

  Fly   843 ELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKH--TMRNVAD-------MGLNIL---FKMLQ 895
            .|.|.:.......|.           :.|:..|.:  |...:|:       .|.:::   .|:||
 Frog   858 ALFQGLRVQMGAPFT-----------EQVIQTFLNMFTREQLAESILQEGSAGCHVVEKFLKILQ 911

  Fly   896 NLDQHPGAAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNLGPIPD 960
            .:.|.||.|   ::.:...||                   ::.:..::.::..|       |.||
 Frog   912 VVVQEPGQA---FKPFLPSIL-------------------SLCMEQLYPIIAER-------PSPD 947

  Fly   961 NMIFIQEYVASLLKSAFTHLSDNQVKVFV--TGLFNLDENVQAFKEHLRDFLIQIREATGED--D 1021
            ....:.|.:..||...:.:...:.|...|  .|.....||...|        :.:.:|.|:.  .
 Frog   948 VKAELFELLFQLLHHNWRYFYRSSVLASVQRDGSDEPMENQAQF--------VVVMQAFGQSFLQ 1004

  Fly  1022 SDLYLEEREAALAEEQSNKHQM 1043
            .|:::..:..:..|..::||::
 Frog  1005 PDIHIFRQNLSYLETLNSKHKL 1026

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 207/1171 (18%)
IBN_N 43..109 CDD:197981 14/66 (21%)
Xpo1 120..265 CDD:285575 41/235 (17%)
CRM1_C 701..1015 CDD:285920 54/346 (16%)
xpo6XP_004918081.1 IBN_N 31..97 CDD:197981 15/75 (20%)
Xpo1 103..277 CDD:285575 36/177 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.