DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and xpo5.2

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_017949446.1 Gene:xpo5.2 XenbaseID:XB-GENE-996403 Length:1114 Species:Xenopus tropicalis

Alignment Length:1059 Identity:204/1060 (19%)
Similarity:354/1060 (33%) Gaps:318/1060 (30%)


  Fly    67 SQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMIL 131
            |.:...:.:.|.:||.|||.||.|:|......:|..:: |:|.....||:.|:..: .:.:..::
 Frog    63 SHSPCVRHFGLHVLEHVIKFRWNVMPLGDRVFVKNRMM-LLISYGIHPILEEKGHI-KDVIARVV 125

  Fly   132 VHILKREWPRNWETFISDIVGAS----KTNESLCMNNMVILKNLSEEVFDFSQG----------Q 182
            |.|:|||||.||...::::...:    :...:|.:.|.:|..|.     :||.|          .
 Frog   126 VEIIKREWPWNWLGMVNELAFTANFGVRNFRTLKLQNSLIFTNR-----NFSSGHFRSIGAHSWN 185

  Fly   183 ITQTKAKHLKDTMCSEFSQIFTLCSF--VLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIE 245
            |..:|....:..|....:.::.||..  |||..|.||      |.||..:|  ..|.:.| :::.
 Frog   186 ILYSKGLPTRLIMADNCTLLWLLCVLLNVLELQMEAA------ECLLLAVN--KKGLLLE-ERVP 241

  Fly   246 TLIFKFLSVPMFRNVTLKCLSEIAGLTAAN-------YDENFATLFKDTMVQLEQIVGQNMNMNH 303
            .||       :||...|:.:     ||||.       .:.|:..|         :::||      
 Frog   242 LLI-------LFREDALRHI-----LTAAQLADSDPLQERNYVIL---------KMIGQ------ 279

  Fly   304 VFKHGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYVDYLNQALMYLVMISEVEDVEVFKICLEY 368
                       ::.:|...||.                 |.|...:     ||:..|.|...||.
 Frog   280 -----------ILCDLGNQLCA-----------------LTQVTAF-----EVKTPETFDRYLEA 311

  Fly   369 WNSLVEDLYNSEFFHPTLESTKRQQVY-------------PRRRFYAPILSKVRFIMISRMAKPE 420
            ..||..        ||:|..|....|.             |:.....|.:.:...:.|.::..|.
 Frog   312 LLSLTR--------HPSLFLTSSAFVIWGTLFSHRVLSHDPQLTAAIPDVLRAAMVSIVKVGYPS 368

  Fly   421 EVLVVENE-NGEVVREFMKDTNSINLY-----KNMRETLVFLTHLDSVDTDRIMTLKLLNQVNG- 478
                ::|. :.|..|....|....|.:     |.|...:..:..||:.....:.|..:.:|::. 
 Frog   369 ----MDNSPSCEYSRLDFDDDTEFNTFFLSFRKQMGIVVRSMCRLDTRTVLHVATEWMRHQLSAP 429

  Fly   479 --------------------SEFSWKNLNTLCWAIGSISGAFC-----EEDEKRFLVTVIKDLLG 518
                                |...|:.::..|   ..:....|     ||...|..|.:::.::|
 Frog   430 LDPGPHNATSGEALCSPHSPSFLHWEAMSFFC---SEVFAQLCRPLSAEEALLREGVRLLQRVIG 491

  Fly   519 LCEQKKGKDNKAIIASNIMYVVGQYPRFLRAH-WKFLKTVVNKLFEF--MHETHDGVQDMACDTF 580
            . |.|    :..|::..:..:....|  |.|| ...:..|:.||...  ..:| ||         
 Frog   492 Y-ETK----DPLIVSCVLTNLASLLP--LIAHAGHLMPLVLQKLLSAAGFADT-DG--------- 539

  Fly   581 IKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVL 645
                       ||: |......|.....|:...:|...|..|...:|.:...|.|.:.|.:....
 Frog   540 -----------VTV-PRTVLRNIRSCAGTLLQTVCVTFPDLVGPCFEVLHTRIKALLGQERLLTG 592

  Fly   646 IERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRIYLDML 710
            .||...:...|   :.|...||....:::     ||.:|:..|:...:.....|:...|.::..|
 Frog   593 AERCALMGALV---LASNHFKNYSRQRSI-----LGELLRPAVSMLLSEEMQRVLSGPREFISFL 649

  Fly   711 NVYKITSENIIQAIEVNGVNVNNQPLIKTMHVV-----KKETLNLISE-----WVSRSNDNQLVM 765
            |  ...|||  |....:|..::...|......:     |....|..:|     :|.....|..| 
 Frog   650 N--NPGSEN--QEEGDDGGRLSYSKLCYCADTLLAAIRKSRRPNQFTEATAGGFVKGRTPNGAV- 709

  Fly   766 DNFIPPLLDAILLDYQRCKVPSAREPKVLSAMAIIVHKLRQ-HITNEVPKIFDAVFECTLDMINK 829
              |:.|....:|              |||..:.:::..:.. ::...:.|:.:.|.:..|::.||
 Frog   710 --FLNPCAGELL--------------KVLDRLLVLIRTMNSLYLPEVMTKMAETVCQSGLEVENK 758

  Fly   830 NFEDFPQ-------HRLSFYELLQAVNAHCFKAFLNI-----PPAQFKLVFDSVVWAFKHTMRNV 882
            :..|..|       ..::..|.||......:||...|     |             :..|...:|
 Frog   759 SIMDCSQPIMGESVPPVTMPEQLQGPYNSLYKACCQILGKCGP-------------SMPHEFYSV 810

  Fly   883 ADMGLNILFKMLQNLDQHPGAAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVE 947
            .|:...:|.....|||            |.:|:.::  .:|.|           ::...:|....
 Frog   811 PDLASRLLSSAFTNLD------------YVSDLHLR--HIVND-----------LVTPLLFYCPS 850

  Fly   948 NRKITVNLGPIPDNMIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQ 1012
            .:..:|.| ||          :..||.|.:..||..                          .:.
 Frog   851 KKYESVVL-PI----------LRPLLMSLYQRLSQK--------------------------WLC 878

  Fly  1013 IREATGEDDSDLYLEEREA 1031
            |.:.|...:.||..||.|:
 Frog   879 INQRTTSSEEDLLEEESES 897

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 199/1050 (19%)
IBN_N 43..109 CDD:197981 14/42 (33%)
Xpo1 120..265 CDD:285575 38/161 (24%)
CRM1_C 701..1015 CDD:285920 57/337 (17%)
xpo5.2XP_017949446.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D40069at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.