DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and LOC100486598

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_002942193.2 Gene:LOC100486598 ID: Length:1243 Species:Xenopus tropicalis

Alignment Length:1143 Identity:217/1144 (19%)
Similarity:377/1144 (33%) Gaps:377/1144 (33%)


  Fly    67 SQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMIL 131
            |.:...:.:.|.:||.|||.||.|:..:....:|..|: |:|.....||:.|:..: .:.:..::
 Frog   103 SHSPCVRHFGLHVLEHVIKFRWNVMSVDDRVFVKNSVM-LLISHGIHPILEEKGHI-KDVIARVV 165

  Fly   132 VHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKH--LKDT 194
            |.|:|||||.||...::::...:...::.....|.||..|:||:.......|.|.|..|  ||:.
 Frog   166 VEIIKREWPWNWLGMVNELAFTANFGDAQMELVMFILLRLAEEIGPLETRPICQPKDLHELLKEN 230

  Fly   195 MCSEFSQIFTLCSFVLENSMNAA-----LIHVTLETLLRFLNWIPLGYIF-ETQQIETLIFKFLS 253
            |...|:.:.|:....:.|..|..     :....|.||..::..:|...|. :...:..|:...|:
 Frog   231 MDKIFAFVVTILQRCVPNCQNLTQGQFRVAAAALRTLAGYIKCLPTHLIMADNCTLLWLLCVLLN 295

  Fly   254 VPMFRNVTLKCLSEIAGLTAAN-----YDEN--FATLFKD-------TMVQLEQIVGQNMNMNHV 304
            ||..:....:||     |.|.|     .:|.  ...||::       |..||..           
 Frog   296 VPELQMEAAECL-----LLAVNKKGLLLEERVPLLILFREDALRYILTAAQLAD----------- 344

  Fly   305 FKHGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYVDYLNQALMYLVMISEVEDVEVFKICLE-- 367
                ||..||  .|..:     ||..|:::.|      |...|...|...||:..|.|...||  
 Frog   345 ----SDPLQE--RNYVI-----LKMIGQILCD------LGNQLCAQVTAFEVKTPETFDRYLEAL 392

  Fly   368 ---------YWNSLVEDLYNSEFFHPTLESTKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEVL 423
                     :..||..:::.:.|.|..|...      |:.....|.:.:...:.|.::..|.   
 Frog   393 LSLTRHPSLFLTSLAAEVWGTLFNHRVLSHD------PQLTAAIPDVLRAAMVSIVKVGYPS--- 448

  Fly   424 VVENE-NGEVVR-EFMKDTN----SINLYKNMRETLVFLTHLDSVDTDRIMTLKLLNQVNG---- 478
             ::|. :.|..| :|..||.    .::.:|.|...:..:..||:.....:.|..:.:|::.    
 Frog   449 -MDNSPSCEYSRMDFDDDTEFNTFFLSFHKQMGIVVRSMCRLDTRTVLHVATEWMRHQLSAPLDP 512

  Fly   479 SEFSWKNLNTLC---------WAIGSISGAFCEEDEKRFLVTVIKDLLGLCEQKKGKDNKAIIAS 534
            ...:..::..||         |...|.   ||.|                               
 Frog   513 GPHNATSVEALCSPHSPSFLHWEAMSF---FCSE------------------------------- 543

  Fly   535 NIMYVVGQYPRFLRAHWKFLKTVVNKLFEFM-HETHDGVQDMACDTFIKIAIKCRRYFVTIQPNE 598
                |..|..|.|.|....|...|:.|.:.: :||.|           .:.:.|           
 Frog   544 ----VFAQLCRPLSAEEVLLTQSVSLLQQVISYETKD-----------PLIVSC----------- 582

  Fly   599 ACTFIDEILTTMSSI---IC---DLQPQQVHTFYEAVGYMISAQVDQVQ---------------- 641
                   :||.:|::   ||   ||.|..:.....|.|:   |..|.|:                
 Frog   583 -------VLTNLSTLLPFICHGSDLLPLMLSKLLSAAGF---ADTDSVKVPRTLLMNIRSCASAL 637

  Fly   642 -QDVLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRI 705
             |.:.| |:..|....::.:.:|       :|.:...:|    |..:...|..:|   .:.|...
 Frog   638 LQTICI-RFPDLVGPHFEVLHTR-------IKALLGQEQ----LLADAERCALMG---ALVLASN 687

  Fly   706 YLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLI---SEWVS--RSN----DN 761
            :....|..:...|.::            ||.:..:  :.:|...::   ||:||  |:|    :|
 Frog   688 HFKNYNRQRSILEELL------------QPAVSML--LSEEMQRVLSGPSEFVSFLRANNPGSEN 738

  Fly   762 QLVMDNFIPPLLDAILLDYQR---------CKVPSAREP-------------------------- 791
            |...|       |...|.|.:         ..:..:|.|                          
 Frog   739 QEEGD-------DGGRLSYSKLCYCAYTFLAAIRKSRRPIIFKEAKAGGFVKGCTPDGVAMLQNP 796

  Fly   792 ------KVLSAMAIIVHKLRQHITNEVP--------KIFDAVFECTLDMINKNFEDFPQHRLSFY 842
                  |||..:.:::..:......||.        |:.:....|.|:|.||:..|         
 Frog   797 CAGELLKVLDRLLVLIRTMNSLYLPEVMTKMAETSLKMAETSQSCELEMGNKSIMD--------- 852

  Fly   843 ELLQAVNAHCFKAFL--NIPPA----QFKLVFDSVVWA-----------FKHTMRNVADMGLNIL 890
                     |.:..:  ::||.    |.:..::|:..|           ..|...:|.|:...:|
 Frog   853 ---------CSQPIMGESVPPVTVPEQLQGPYNSLYKACCQILGKCGPSMPHEFYSVPDLASRLL 908

  Fly   891 FKMLQNLDQHPGAAQSFYQTYFTDILMQ----------IFSVVTDTSHTAGLPNHAIILAYMFSL 945
            .....|||            |.:|:.::          ||...:....:..||....:|..::..
 Frog   909 SSAFTNLD------------YVSDLNLRHIVIDLVTPLIFYCPSKKYQSVALPILGPLLMSLYQR 961

  Fly   946 VENRKITVNLGPIPDNMIFIQEYVAS---LLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLR 1007
            :..:.:.:|           |...||   ||:.......|..|::       |...|..|     
 Frog   962 LSQKWLCIN-----------QRTTASEEDLLEEESESQDDLMVRL-------LSRTVVQF----- 1003

  Fly  1008 DFLIQI----REATGEDDSDLYLEER--EAALAEEQSN 1039
               |.|    ...|.:.|:|..:..|  :|...||:.|
 Frog  1004 ---IYICCMASHTTYQSDADYRIAPRVEQAEADEEEEN 1038

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 211/1124 (19%)
IBN_N 43..109 CDD:197981 14/42 (33%)
Xpo1 120..265 CDD:285575 36/153 (24%)
CRM1_C 701..1015 CDD:285920 65/406 (16%)
LOC100486598XP_002942193.2 IBN_N 78..145 CDD:197981 14/43 (33%)
Xpo1 156..307 CDD:285575 36/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D40069at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.