DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emb and xpo1

Sequence 1:NP_001303316.1 Gene:emb FlyBaseID:FBgn0020497 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_002939551.2 Gene:xpo1 XenbaseID:XB-GENE-993240 Length:1071 Species:Xenopus tropicalis

Alignment Length:1068 Identity:756/1069 (71%)
Similarity:888/1069 (83%) Gaps:10/1069 (1%)


  Fly     3 TMLTSDEAGKLLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYS 67
            |||....|.:||||||||||||||.:|..:|..:|.|.|:||.:||.|||||:||||||:|||:|
 Frog     6 TMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFS 70

  Fly    68 QNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILV 132
            ||..||:|.|||||.|||||||:||||||||||||||.||||||||...:|:.|||:.|||||||
 Frog    71 QNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDATCVEKEKVYIGKLNMILV 135

  Fly   133 HILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCS 197
            .|||:|||::|.||||||||||:|:||||.|||||||.|||||||||.|||||.|||||||:||:
 Frog   136 QILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCN 200

  Fly   198 EFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNVTL 262
            ||||||.||.||:|||.||.|:|.||||||||||||||||||||:.|.|||:|||:|||||||:|
 Frog   201 EFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSL 265

  Fly   263 KCLSEIAGLTAANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFL 327
            |||:||||::.:.|:|.|.|||..||:||:|::..|.|:...:.:|.|.||..:.||::||||||
 Frog   266 KCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFL 330

  Fly   328 KEHGKLVEDAKYV-DYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNSEFF----HPTLE 387
            ||||:|:|....: :.|.:||.|::::||||:.|:|||||||||.|..:||....|    .|.|.
 Frog   331 KEHGQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLS 395

  Fly   388 STKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLYKNMRET 452
            .::...|.|||:.|.|:|||||.:|:||||||||||||||:.|||||||||||:|||||||||||
 Frog   396 GSQHFDVPPRRQLYLPVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRET 460

  Fly   453 LVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIKDLL 517
            ||:|||||..||:||||.||.|||||:|:||||||||||||||||||..||||||||||||||||
 Frog   461 LVYLTHLDYADTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLL 525

  Fly   518 GLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIK 582
            ||||||:||||||||||||||:|||||||||||||||||||||||||||||||||||||||||||
 Frog   526 GLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIK 590

  Fly   583 IAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVLIE 647
            ||.||||:||.:|..|...||||||..:::|||||||||||||||||||||.||.||..|:.|||
 Frog   591 IAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIE 655

  Fly   648 RYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRIYLDMLNV 712
            :||.|||||||.||.:|:||||.||:...||||||||||||.||||:||.:||||||||||||||
 Frog   656 KYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV 720

  Fly   713 YKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLLDAIL 777
            ||..||||..||:.||..|..||||::|..||:|||.|||.|||||:|.|:|.:||:||||||:|
 Frog   721 YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSSDPQMVAENFVPPLLDAVL 785

  Fly   778 LDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFY 842
            :|||| .||:||||:|||.||.||:||..|||.|:|:||||||||||:||||:||::|:||.:|:
 Frog   786 IDYQR-NVPAAREPEVLSTMATIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFF 849

  Fly   843 ELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLDQHPGAAQSF 907
            .||||||:|||.|||.|||||||||.||::||||||||||||.||.||:.:|||:.|...|||||
 Frog   850 LLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTLLQNVAQEEAAAQSF 914

  Fly   908 YQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNL---GPIPDNMIFIQEYV 969
            |||||.|||..||||||||||||||..||.||||||:|||..||:..|   .|: .|.:||||||
 Frog   915 YQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNQASPL-SNQLFIQEYV 978

  Fly   970 ASLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYLEEREAALA 1034
            |:||||||.||.|.|||:||||||:|::::.||||||||||:||:|..|||.|||:|||||::|.
 Frog   979 ANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEYAGEDTSDLFLEERESSLR 1043

  Fly  1035 EEQSNKHQMQRNIPGMLNPHELPEDMQD 1062
            :.|..||::|.::||:|||||:||:|.|
 Frog  1044 QAQEEKHKLQMSVPGILNPHEIPEEMCD 1071

Known Domains:


GeneSequenceDomainRegion External IDIdentity
embNP_001303316.1 CRM1 13..1023 CDD:227432 729/1018 (72%)
IBN_N 43..109 CDD:197981 53/66 (80%)
Xpo1 120..265 CDD:285575 116/145 (80%)
CRM1_C 701..1015 CDD:285920 221/317 (70%)
xpo1XP_002939551.2 CRM1 15..1044 CDD:227432 737/1031 (71%)
IBN_N 46..112 CDD:197981 53/66 (80%)
Xpo1 123..268 CDD:285575 116/145 (80%)
CRM1_C 709..1026 CDD:285920 222/319 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25570598
eggNOG 1 0.900 E1_COG5101
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2554
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D132850at2759
OrthoFinder 1 1.000 FOG0002975
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.