DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fy and FUZ

Sequence 1:NP_001260250.1 Gene:fy FlyBaseID:FBgn0001084 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001339191.1 Gene:FUZ HGNCID:26219 Length:419 Species:Homo sapiens

Alignment Length:440 Identity:128/441 (29%)
Similarity:210/441 (48%) Gaps:69/441 (16%)


  Fly     2 SIYLLCLTTNGGLPVFTR-KKGEC---ENLPFSTVASLNGFHMFFKSLGIQLEATTTSKQQPIQN 62
            :::||||..:.|:|:|.| .:|..   :.||||.:.||||.|||.::|.:||.:..|        
Human     9 TVHLLCLAASSGVPLFCRSSRGGAPARQQLPFSVIGSLNGVHMFGQNLEVQLSSART-------- 65

  Fly    63 QAPADAEEWTYIWRD-RESITLIVCGCGVG-SEQLLQTLADLVFGAIGMFITRAAEMAHATLLDR 125
                  |..|.:|:. .:||||||....|| ||..|:.|..:||||: :.:....|:.:...::|
Human    66 ------ENTTVVWKSFHDSITLIVLSSEVGISELRLERLLQMVFGAM-VLLVGLEELTNIRNVER 123

  Fly   126 LKKDAKKYVPIVDAILEAACAGTQLLG----YTDCLLAAENAQLLQCLNEFSGHCGSLFCCLVVG 186
            ||||.:....::|:.|    ..::|:|    ..||::..|.:.|.:.|:.|:...|:.|..|||.
Human   124 LKKDLRASYCLIDSFL----GDSELIGDLTQCVDCVIPPEGSLLQEALSGFAEAAGTTFVSLVVS 184

  Fly   187 HRIAVATEGWWDLDTRDRELLLFLLNS-SSTMQHDVPVYLPVKSPHIAYRFVSIPVASNSALCVL 250
            .|:..||||||.|.|.:..||.:|:.| ......|.|||||..||.:.:|.:::.:..:..||:|
Human   185 GRVVAATEGWWRLGTPEAVLLPWLVGSLPPQTARDYPVYLPHGSPTVPHRLLTLTLLPSLELCLL 249

  Fly   251 CGAENASFRELHAHAMSAYRNEGNLLAAAERCV---PRSLPEHLEIDGNVLAIILINRHTRKSLF 312
            || .:....:|:...:..:...  ||.....|:   ||:||....:..::|.::|::...::.||
Human   250 CG-PSPPLSQLYPQLLERWWQP--LLDPLRACLPLGPRALPSGFPLHTDILGLLLLHLELKRCLF 311

  Fly   313 TRNLNQSASVKRIIVGDL------QRLDILKKFFDQTMDAVHQFETQSSSNKTTLVDQYSCSDYH 371
            |        |:.:  ||.      ||..:|:.|:  |:.....|..:....:.|..:.|......
Human   312 T--------VEPL--GDKAEPSPEQRRRLLRNFY--TLVTSTHFPPEPGPPEKTEDEVYQAQLPR 364

  Fly   372 KCYAHMD-------------ELG-NVIFLLFVAAVPSHAMRFLA-QRIHA 406
            .||..:.             :|| ..:.||.....|:|.:|.|| ..:||
Human   365 ACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHA 414



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198823224
eggNOG 1 0.900 E1_28P1D
Hieranoid 1 1.000
Homologene 1 1.000 H11840
Inparanoid 1 1.050 152 1.000 Inparanoid score I4290
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D317877at33208
OrthoFinder 1 1.000 FOG0006995
OrthoInspector 1 1.000 T1072455
orthoMCL 1 0.900 OOG5_134645
Panther 1 1.100 LDO PTHR13559
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7548
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.