DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fy and fuz

Sequence 1:NP_001260250.1 Gene:fy FlyBaseID:FBgn0001084 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_001337543.1 Gene:fuz ZFINID:ZDB-GENE-090609-2 Length:420 Species:Danio rerio

Alignment Length:429 Identity:127/430 (30%)
Similarity:209/430 (49%) Gaps:56/430 (13%)


  Fly     2 SIYLLCLTTNGGLPVFTRKKGECENLPFSTVASLNGFHMFFKSLGIQLEATTTSKQQPIQNQAPA 66
            ::.|||||.:.|:|:|:|  |..:.||||.:.||||.|||....|.||.:..|.:...:      
Zfish     6 TLQLLCLTASSGVPLFSR--GSSKQLPFSVIGSLNGVHMFGAGHGAQLSSCETDRGSRV------ 62

  Fly    67 DAEEWTYIWR-DRESITLI-VCGCGVGS-EQL-LQTLADLVFGAIGMFITRAAEMAHATLLDRLK 127
                   :|. .::|:.|| |.|.|..| .|| |:.|.:.|:..: :.:....|::....::|||
Zfish    63 -------VWGVFQDSLMLIAVSGSGGSSISQLQLRRLLENVWNCM-VLVLGQDELSSIRNVERLK 119

  Fly   128 KDAKKYVPIVDAILEAACAGTQLLG----YTDCLLAAENAQLLQ-CLNEFSGHCGSLFCCLVVGH 187
            ::.:....::|.:||........:|    .|||||.:.:..||| .::.|:....|.|.||::..
Zfish   120 RELRSCYRLIDMLLERVNDEEGFMGDLTQCTDCLLPSHSGLLLQEAVDSFAQATESEFGCLLLNG 184

  Fly   188 RIAVATEGWWDLDTRDRELLLFLL-----NSSSTMQHDVPVYLPVKSPHIAYRFVSIPVASNSAL 247
            |:|.|||.||...|....::|.:|     ::||.   |.||:||..||.:|.|.:|..:.....:
Zfish   185 RVARATEKWWSRLTPQEVVVLSVLVRSLADASSC---DYPVFLPKGSPTVAIRLLSFQLLPGVHV 246

  Fly   248 CVLCGAE----NASFRELHAHAMSAYRNEGNLLAAAERCVPRSLPEHLEIDGNVLAIILINRHTR 308
            |||||.:    |||  ||.:...|....  ||....|:....|||..:.:..:|.|::|||..:|
Zfish   247 CVLCGPKPSLHNAS--ELISRFWSTLVE--NLRTCLEQAKRSSLPPSVSLRWDVQALLLINCDSR 307

  Fly   309 KSLFT---RNLNQSASVKRIIVGDLQRLDILKKFFDQTMDAVHQFETQSSSNKTTL--------V 362
            ::|..   ..:...|.....::...:||::|:.|:   :.||.::.|...|..:..        |
Zfish   308 RALTVCPRVRVGAPAEDTPPLISTARRLELLRLFY---VFAVTRYFTSQESTASDFAQGFTHVPV 369

  Fly   363 DQYSCSDYHKCYAHMDELGNVIFLLFVAAVPSHAMRFLA 401
            ..|..:|..||:. :....:.:|||...:||:.|:|.:|
Zfish   370 QCYLVTDECKCFG-LQSPQHQLFLLMDPSVPTFALRTVA 407



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198823336
eggNOG 1 0.900 E1_28P1D
Hieranoid 1 1.000
Homologene 1 1.000 H11840
Inparanoid 1 1.050 135 1.000 Inparanoid score I4484
OMA 1 1.010
OrthoDB 1 1.010 D317877at33208
OrthoFinder 1 1.000 FOG0006995
OrthoInspector 1 1.000 T1051888
orthoMCL 1 0.900 OOG5_134645
Panther 1 1.100 LDO PTHR13559
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7548
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.