DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fy and Fuz

Sequence 1:NP_001260250.1 Gene:fy FlyBaseID:FBgn0001084 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_006541254.1 Gene:Fuz MGIID:1917550 Length:440 Species:Mus musculus

Alignment Length:453 Identity:121/454 (27%)
Similarity:204/454 (45%) Gaps:83/454 (18%)


  Fly     3 IYLLCLTTNGGLPVFTRKKG----ECENLPFSTVASLNGFHMFFKSLGIQLEATTTSKQQPIQNQ 63
            ::||||..:.|:|:|.|...    ..:.||||.:.||||.|||.::|.:||.:..|         
Mouse    10 VHLLCLAASSGVPLFCRSSSGGAPSRQQLPFSVIGSLNGVHMFGQNLDVQLNSART--------- 65

  Fly    64 APADAEEWTYIWRD-RESITLIVCGCGVGSEQL-LQTLADLVFGAIGMFITRAAEMAHATLLDRL 126
                 |:.|.:|:: .:||||||.....|:.:| |:.:..:||||: :.|....|:.:...::||
Mouse    66 -----EDTTVVWKNFHDSITLIVLSSEEGTSELRLERMLHMVFGAM-VLIVGLEELTNIRNVERL 124

  Fly   127 KKDAKKYVPIVDAILEAACAGTQLLG----YTDCLLAAENAQLLQCLNEFSGHCGSLFCCLVVGH 187
            ||:.:....::|:.|    ..::|:|    ..||::..|.:.:.:.|:.|:...|:.|..|:|..
Mouse   125 KKELRASYCLIDSFL----GNSELIGDLTQCVDCVIPPEGSAMQETLSGFAEATGTAFVSLLVSG 185

  Fly   188 RIAVATEGWWDLDTRDRELLLFLLNS-SSTMQHDVPVYLPVKSP--------------------- 230
            |:..||||||.|...:..||.:|:.| ......|.|||||..||                     
Mouse   186 RVVAATEGWWRLGMPEAVLLPWLVGSLPPQAARDYPVYLPHGSPTVSGRDQGGASSRAGPCLALS 250

  Fly   231 ----HIAYRFVSIPVASNSALCVLCGAENASFRELHAHAMSAYRNEGNLLAAAERCV---PRSLP 288
                .:.:|.:::.:.....||:||| ......:|....|..:...  ||.....|:   ||:||
Mouse   251 CARLQVPHRLLTLTLLRGLELCLLCG-PRPPLGQLDPQLMERWWQP--LLEPLRACLPLGPRALP 312

  Fly   289 EHLEIDGNVLAIILINRHTRKSLFT--RNLNQSASVKRIIVGDLQRLDILKKFFDQTMDAVHQFE 351
            |...:..::|.::|::...|:.|||  .:.::..|.:       ||..:|:.|:  |:.|...|.
Mouse   313 EGFPLHSDILGLLLLHLELRRCLFTVEPSKDKEPSPE-------QRRRLLRNFY--TLVATTHFP 368

  Fly   352 TQSSSNKTTLVDQYSCSDYHKCYAHMD----------ELG-NVIFLLFVAAVPSHAMRFLAQR 403
            .:....:......|.......||..:.          :|| .::.||.....|:|.:|.||.|
Mouse   369 PEPGPAEKQEDTVYPAQMPRACYLVLGPGMGWQLVAVQLGLRLLLLLLSPHTPTHGLRSLATR 431



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198823593
eggNOG 1 0.900 E1_28P1D
Hieranoid 1 1.000
Homologene 1 1.000 H11840
Inparanoid 1 1.050 154 1.000 Inparanoid score I4283
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006995
OrthoInspector 1 1.000 T1082521
orthoMCL 1 0.900 OOG5_134645
Panther 1 1.100 LDO PTHR13559
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7548
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.