DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fy and Fuz

Sequence 1:NP_001260250.1 Gene:fy FlyBaseID:FBgn0001084 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_006229121.1 Gene:Fuz RGDID:1310608 Length:415 Species:Rattus norvegicus

Alignment Length:442 Identity:116/443 (26%)
Similarity:204/443 (46%) Gaps:88/443 (20%)


  Fly     2 SIYLLCLTTNGGLPVFTRKKG----ECENLPFSTVASLNGFHMFFKSLGIQLEATTTSKQQPIQN 62
            :::||||..:.|:|:|.|...    ..:.||||.:.||||.|||.::|.:||.:..|        
  Rat     9 TVHLLCLAASSGVPLFCRSSSGGAPSRQQLPFSVIGSLNGVHMFGQNLDVQLNSART-------- 65

  Fly    63 QAPADAEEWTYIWRD-RESITLIVCGCGVGSEQL-LQTLADLVFGAIGMFITRAAEMAHATLLDR 125
                  |:.|.:|:: .:|||||......|:.:| |:.:..:||||: :.|....|:.:...::|
  Rat    66 ------EDTTVVWKNFHDSITLIALSSEEGTSELKLERMLHMVFGAM-VLIVGLEELTNIRNVER 123

  Fly   126 LKKDAKKYVPIVDAILEAACAGTQLLG----YTDCLLAAENAQLLQCLNEFSGHCGSLFCCLVVG 186
            |||:.:....::|:.|    ..::|:|    ..||::..|.:.:.:.|:.|:...|:.|..|:|.
  Rat   124 LKKELRASYCLIDSFL----GNSELIGDLTQCVDCVIPPEGSVMQETLSGFAEATGTAFVSLLVS 184

  Fly   187 HRIAVATEGWWDLDTRDRELLLFLLNS-SSTMQHDVPVYLPVKSPHIAYRFVSIPVASNSALCVL 250
            .|:..||:|||.|...:..||.:|:.| ......|.|||||..||.:.:|.:::.:.....||:|
  Rat   185 GRVVAATDGWWRLGMPEAVLLPWLVGSLPPQAARDYPVYLPHGSPTVPHRLLTLTLLRGLELCLL 249

  Fly   251 CGAENASFRELHAHAMSAYRNEGNLLAAAERCV---PRSLPEHLEIDGNVLAIILINRHTRKSLF 312
            || ......||....:..:...  ||.....|:   ||:||:...:..::|.::|::...|:.||
  Rat   250 CG-PRPPLGELDPQLLERWWQP--LLEPLRACLPLGPRALPDGFPLHSDILGLLLLHLELRRCLF 311

  Fly   313 T--RNLNQSASVKRIIVGDLQRLDILKKFF---------------DQTMDAVHQFETQSSSNKTT 360
            |  .:.::..|.:       ||..:|:.|:               ::..|.||..:|..:     
  Rat   312 TVEPSKDKEPSPE-------QRRRLLRNFYTLVATTHFPPEPGPAEKQEDTVHPAQTPRA----- 364

  Fly   361 LVDQYSCSDYHKCYAHMD----------ELG-NVIFLLFVAAVPSHAMRFLA 401
                        ||..:.          :|| .::.|:.....|:|.:|.||
  Rat   365 ------------CYLVLGPGMGWQLVAVQLGLRLLLLMLSPQTPTHGLRSLA 404



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198821029
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H11840
Inparanoid 1 1.050 146 1.000 Inparanoid score I4265
OMA 1 1.010
OrthoDB 1 1.010 D317877at33208
OrthoFinder 1 1.000 FOG0006995
OrthoInspector 1 1.000 T1086115
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13559
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.