DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp29AB and CD302

Sequence 1:NP_523512.2 Gene:Acp29AB FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_055695.2 Gene:CD302 HGNCID:30843 Length:232 Species:Homo sapiens

Alignment Length:87 Identity:20/88 (23%)
Similarity:34/88 (39%) Gaps:21/88 (24%)


  Fly   155 LDGIL---ALAPNNSYWID----ISKLVENGGTFVSTLTGREPFFVKWKSNQDTK---------- 202
            ::|.|   |:.....|..|    ||.|| ...|.:.|:.|...:|: :|.:.|::          
Human   148 VEGTLCKTAIPYKRKYLSDNHILISALV-IASTVILTVLGAIIWFL-YKKHSDSRFTTVFSTAPQ 210

  Fly   203 --KKNQCVYIYAKEMSYDECFE 222
              ....||.:..:|..|...|:
Human   211 SPYNEDCVLVVGEENEYPVQFD 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 20/88 (23%)
CD302NP_055695.2 CLECT 24..154 CDD:214480 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22803
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.