DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp29AB and Clec2l

Sequence 1:NP_523512.2 Gene:Acp29AB FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001094977.1 Gene:Clec2l MGIID:2141402 Length:211 Species:Mus musculus

Alignment Length:105 Identity:21/106 (20%)
Similarity:36/106 (34%) Gaps:25/106 (24%)


  Fly   132 WFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVE-----NGGTF---VSTLTGR 188
            |......|......||.||.:.||:.:.... ....||.:.::.:     ||..|   ..|::| 
Mouse   118 WNTGRQYCHTHEAALAVIQSQKELEFMFKFT-RREPWIGLRRVGDDFHWVNGDPFDPDTFTISG- 180

  Fly   189 EPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVC 228
                           ..:||::....:...||...:.:||
Mouse   181 ---------------MGECVFVEPTRLVSTECLTTRPWVC 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/106 (20%)
Clec2lNP_001094977.1 CLECT_NK_receptors_like 97..207 CDD:153063 21/106 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.