DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klrh1

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_631926.1 Gene:Klrh1 / 246043 RGDID:621452 Length:231 Species:Rattus norvegicus


Alignment Length:125 Identity:32/125 - (25%)
Similarity:48/125 - (38%) Gaps:37/125 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVK 194
            :||.|:..:||.:..|||.| |..|....:....|.|||:.:.|   .||.|:            
  Rat   123 KTWDESEASCRLLGSHLAKI-DNREEQNFIQSRLNYSYWVGLRK---KGGQFL------------ 171

  Fly   195 WKSNQDTKKKNQ-------------CVYIYAKEMSYDECFE------KKSFVC--QADQW 233
            |...:|.|..:.             |.||..|.::..:|..      ||:|.|  .::.|
  Rat   172 WVHQEDEKISSDLDFHMTTHLADAACGYIKPKLLNNAQCSRLFPYICKKNFTCLLTSENW 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 31/119 (26%)
Klrh1NP_631926.1 Ly49 36..118 CDD:462461
CLECT_NK_receptors_like 104..220 CDD:153063 27/112 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.