DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp29AB and Sftpd

Sequence 1:NP_523512.2 Gene:Acp29AB FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_033186.1 Gene:Sftpd MGIID:109515 Length:374 Species:Mus musculus

Alignment Length:160 Identity:37/161 (23%)
Similarity:66/161 (41%) Gaps:25/161 (16%)


  Fly    82 KAQMEI---QLQPLKIIMRHHASNIKASNNIKMRRF---EKVGSRHFHIEKNLMQTWFEAYVTCR 140
            :.|||.   :||.|::...|:.         |...|   ..||.:.|....: .:.:.:|...|:
Mouse   227 RQQMEALKGKLQRLEVAFSHYQ---------KAALFPDGRSVGDKIFRTADS-EKPFEDAQEMCK 281

  Fly   141 KMNGHLANIQDEMELDGI--LALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKW---KSNQD 200
            :..|.||:.:...|...|  |..|.|.:.::.::. |...|.|... ||....:..|   :.|.:
Mouse   282 QAGGQLASPRSATENAAIQQLITAHNKAAFLSMTD-VGTEGKFTYP-TGEPLVYSNWAPGEPNNN 344

  Fly   201 TKKKNQCVYIYAKEMSYDE-CFEKKSFVCQ 229
            ...:| ||.|:......|: |.|::..:|:
Mouse   345 GGAEN-CVEIFTNGQWNDKACGEQRLVICE 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 26/114 (23%)
SftpdNP_033186.1 Collagen 45..102 CDD:189968
Collagen 129..>171 CDD:189968
Surfac_D-trimer 223..267 CDD:286141 12/49 (24%)
CLECT_collectin_like 261..374 CDD:153061 26/118 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.