DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp29AB and Sftpa1

Sequence 1:NP_523512.2 Gene:Acp29AB FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_075623.2 Gene:Sftpa1 MGIID:109518 Length:248 Species:Mus musculus

Alignment Length:105 Identity:18/106 (17%)
Similarity:40/106 (38%) Gaps:26/106 (25%)


  Fly   139 CRKMNGHLANIQDEMELDGILALAPN-NSYWIDISKLVENGGTFVSTLTGREP-----------F 191
            |.:..||:|..::..|.:.|.::... |:|            .::..:.|:.|           .
Mouse   155 CTRAGGHIAAPRNPEENEAIASITKKYNTY------------PYLGVIEGQTPGDFHYLDGASVN 207

  Fly   192 FVKWKSNQDT-KKKNQCVYIYAKEMSYDE-CFEKKSFVCQ 229
            :..|...:.. :.|.:||.:|......|: |.:.:..:|:
Mouse   208 YTNWYPGEPRGRGKEKCVEMYTDGKWNDKGCLQYRLAICE 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 18/104 (17%)
Sftpa1NP_075623.2 Collagen 27..98 CDD:189968
CLECT_collectin_like 136..248 CDD:153061 18/106 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.