DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp29AB and CLEC12A

Sequence 1:NP_523512.2 Gene:Acp29AB FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_006719096.1 Gene:CLEC12A HGNCID:31713 Length:282 Species:Homo sapiens

Alignment Length:102 Identity:24/103 (23%)
Similarity:44/103 (43%) Gaps:4/103 (4%)


  Fly   129 MQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVEN-GGTFVSTLTGREPFF 192
            :|||.|:.:.|...|..|..|.::..|:.|.:.:.:..||:.:|...:: .|..|..:.....:.
Human   168 VQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWV 232

  Fly   193 VKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQ 229
            ::   |........|.||....:.|..|..||..:|:
Human   233 IR---NAPDLNNMYCGYINRLYVQYYHCTYKKRMICE 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 24/101 (24%)
CLEC12AXP_006719096.1 CLECT_NK_receptors_like 150..267 CDD:153063 24/103 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.