DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dad1 and OST2

Sequence 1:NP_609222.1 Gene:Dad1 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_014746.2 Gene:OST2 SGDID:S000005629 Length:130 Species:Saccharomyces cerevisiae

Alignment Length:118 Identity:48/119 (40%)
Similarity:69/119 (58%) Gaps:16/119 (13%)


  Fly     5 SSVISKF----------YNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLV-GTFPFNSFLSG 58
            |:|::.|          |...::..| ||||:|.:..:::|.|:||..:..|: ..||||:||:|
Yeast    17 SAVLTDFQETFKTSKRAYFAQIEKYP-KLKLIDTFCFFLVLLGVIQCTFIILIRDNFPFNAFLAG 80

  Fly    59 FISTVSCFVLAVCLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFI 111
            ||..|..|||.:.||||.    .:.|.|||..|.||:||.|.:|||.|.::||
Yeast    81 FIICVGQFVLLMSLRLQL----CNSFPGISKNRAFAEFIVASLILHFVCLHFI 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:280306 48/119 (40%)
OST2NP_014746.2 DAD 24..130 CDD:307979 45/112 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C227288480
eggNOG 1 0.900 E1_KOG1746
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1619
Isobase 1 0.950 0 Normalized mean entropy S554
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003847
OrthoInspector 1 1.000 T1136491
orthoMCL 1 0.900 OOG5_129124
Panther 1 1.100 LDO PTHR10705
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R877
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.