powered by:
                   
 
    
    
             
          
            Protein Alignment Dad1 and OST2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_609222.1 | Gene: | Dad1 / 34159 | FlyBaseID: | FBgn0263852 | Length: | 112 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_014746.2 | Gene: | OST2 / 854270 | SGDID: | S000005629 | Length: | 130 | Species: | Saccharomyces cerevisiae | 
        
        
        
          
            | Alignment Length: | 118 | Identity: | 48/118 - (40%) | 
          
            | Similarity: | 69/118 -  (58%) | Gaps: | 16/118 - (13%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     5 SSVISKF----------YNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLV-GTFPFNSFLSG 58|:|::.|          |...::..| ||||:|.:..:::|.|:||..:..|: ..||||:||:|
 Yeast    17 SAVLTDFQETFKTSKRAYFAQIEKYP-KLKLIDTFCFFLVLLGVIQCTFIILIRDNFPFNAFLAG 80
 
 
  Fly    59 FISTVSCFVLAVCLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFI 111||..|..|||.:.||||.    .:.|.|||..|.||:||.|.:|||.|.::||
 Yeast    81 FIICVGQFVLLMSLRLQL----CNSFPGISKNRAFAEFIVASLILHFVCLHFI 129
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | Dad1 | NP_609222.1 | DAD | 5..112 | CDD:396608 | 48/118 (41%) | 
          
            | OST2 | NP_014746.2 | DAD | 24..130 | CDD:396608 | 45/111 (41%) | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C157343473 | 
          
            | Domainoid | 1 | 1.000 | 77 | 1.000 | Domainoid score | I2091 | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_KOG1746 | 
          
            | Hieranoid | 1 | 1.000 | - | - |  |  | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 1 | 1.050 | 77 | 1.000 | Inparanoid score | I1643 | 
          
            | Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S554 | 
          
            | OMA | 1 | 1.010 | - | - |  | QHG54385 | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0004116 | 
          
            | OrthoInspector | 1 | 1.000 | - | - |  | oto99028 | 
          
            | orthoMCL | 1 | 0.900 | - | - |  | OOG6_103289 | 
          
            | Panther | 1 | 1.100 | - | - | LDO | PTHR10705 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R877 | 
          
            | SonicParanoid | 1 | 1.000 | - | - |  | X2855 | 
          
            | TreeFam | 1 | 0.960 | - | - |  |  | 
          
            |  | 15 | 14.740 |  | 
        
      
           
             Return to query results.
             Submit another query.