DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dad1 and OST2

DIOPT Version :9

Sequence 1:NP_609222.1 Gene:Dad1 / 34159 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_014746.2 Gene:OST2 / 854270 SGDID:S000005629 Length:130 Species:Saccharomyces cerevisiae


Alignment Length:118 Identity:48/118 - (40%)
Similarity:69/118 - (58%) Gaps:16/118 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSVISKF----------YNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLV-GTFPFNSFLSG 58
            |:|::.|          |...::..| ||||:|.:..:::|.|:||..:..|: ..||||:||:|
Yeast    17 SAVLTDFQETFKTSKRAYFAQIEKYP-KLKLIDTFCFFLVLLGVIQCTFIILIRDNFPFNAFLAG 80

  Fly    59 FISTVSCFVLAVCLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFI 111
            ||..|..|||.:.||||.    .:.|.|||..|.||:||.|.:|||.|.::||
Yeast    81 FIICVGQFVLLMSLRLQL----CNSFPGISKNRAFAEFIVASLILHFVCLHFI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:396608 48/118 (41%)
OST2NP_014746.2 DAD 24..130 CDD:396608 45/111 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343473
Domainoid 1 1.000 77 1.000 Domainoid score I2091
eggNOG 1 0.900 - - E1_KOG1746
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1643
Isobase 1 0.950 - 0 Normalized mean entropy S554
OMA 1 1.010 - - QHG54385
OrthoFinder 1 1.000 - - FOG0004116
OrthoInspector 1 1.000 - - oto99028
orthoMCL 1 0.900 - - OOG6_103289
Panther 1 1.100 - - LDO PTHR10705
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R877
SonicParanoid 1 1.000 - - X2855
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.