DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dad1 and ATDAD1

DIOPT Version :9

Sequence 1:NP_609222.1 Gene:Dad1 / 34159 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_174500.1 Gene:ATDAD1 / 840113 AraportID:AT1G32210 Length:115 Species:Arabidopsis thaliana


Alignment Length:94 Identity:50/94 - (53%)
Similarity:71/94 - (75%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCFVLAVCLRLQANPQNKSV 83
            ||..||::|:|:.:.:.|.:||.||..|||:|||||||||.:|.:...|||||||:|.|.:||. 
plant    23 TPTNLKIIDLYVVFAVFTALIQVVYMALVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKENKE- 86

  Fly    84 FAGISPERGFADFIFAHVILHLVVMNFIG 112
            |..::|||.||||:..:::||||::||:|
plant    87 FKDLAPERAFADFVLCNLVLHLVIINFLG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:396608 49/92 (53%)
ATDAD1NP_174500.1 DAD 10..115 CDD:396608 49/92 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 112 1.000 Domainoid score I2062
eggNOG 1 0.900 - - E1_KOG1746
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1027
Inparanoid 1 1.050 112 1.000 Inparanoid score I2055
OMA 1 1.010 - - QHG54385
OrthoDB 1 1.010 - - D1586516at2759
OrthoFinder 1 1.000 - - FOG0004116
OrthoInspector 1 1.000 - - otm3166
orthoMCL 1 0.900 - - OOG6_103289
Panther 1 1.100 - - LDO PTHR10705
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2855
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.930

Return to query results.
Submit another query.