DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dad1 and ATDAD1

Sequence 1:NP_609222.1 Gene:Dad1 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_174500.1 Gene:ATDAD1 AraportID:AT1G32210 Length:115 Species:Arabidopsis thaliana

Alignment Length:94 Identity:50/95 (53%)
Similarity:71/95 (75%) Gaps:1/95 (1%)


  Fly    19 TPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCFVLAVCLRLQANPQNKSV 83
            ||..||::|:|:.:.:.|.:||.||..|||:|||||||||.:|.:...|||||||:|.|.:||. 
plant    23 TPTNLKIIDLYVVFAVFTALIQVVYMALVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKENKE- 86

  Fly    84 FAGISPERGFADFIFAHVILHLVVMNFIG 112
            |..::|||.||||:..:::||||::||:|
plant    87 FKDLAPERAFADFVLCNLVLHLVIINFLG 115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:280306 49/93 (53%)
ATDAD1NP_174500.1 DAD 10..115 CDD:280306 49/93 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1027
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1586516at2759
OrthoInspector 1 1.000 T124988
orthoMCL 1 0.900 OOG5_129124
Panther 1 1.100 O PTHR10705
Phylome 1 0.910 0.667 Consistency score
87.930

Return to query results.
Submit another query.