DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dad1 and DAD2

DIOPT Version :10

Sequence 1:NP_609222.1 Gene:Dad1 / 34159 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_850247.1 Gene:DAD2 / 818117 AraportID:AT2G35520 Length:116 Species:Arabidopsis thaliana


Alignment Length:95 Identity:50/95 - (52%)
Similarity:71/95 - (74%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TPKKLKLVDIYLGYILLTGIIQFV-YCCLVGTFPFNSFLSGFISTVSCFVLAVCLRLQANPQNKS 82
            ||..||::|:|:.:.:.|.:||.| |..|||:|||||||||.:|.:...|||||||:|.|.:||.
plant    23 TPTNLKIIDLYVCFAVFTALIQQVAYMALVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKENKE 87

  Fly    83 VFAGISPERGFADFIFAHVILHLVVMNFIG 112
             |..::|||.||||:..:::||||::||:|
plant    88 -FKDLAPERAFADFVLCNLVLHLVIINFLG 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:460448 49/93 (53%)
DAD2NP_850247.1 DAD 10..116 CDD:460448 49/93 (53%)

Return to query results.
Submit another query.