DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dad1 and DAD2

Sequence 1:NP_609222.1 Gene:Dad1 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_850247.1 Gene:DAD2 AraportID:AT2G35520 Length:116 Species:Arabidopsis thaliana

Alignment Length:95 Identity:50/96 (52%)
Similarity:71/96 (74%) Gaps:2/96 (2%)


  Fly    19 TPKKLKLVDIYLGYILLTGIIQFV-YCCLVGTFPFNSFLSGFISTVSCFVLAVCLRLQANPQNKS 82
            ||..||::|:|:.:.:.|.:||.| |..|||:|||||||||.:|.:...|||||||:|.|.:||.
plant    23 TPTNLKIIDLYVCFAVFTALIQQVAYMALVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKENKE 87

  Fly    83 VFAGISPERGFADFIFAHVILHLVVMNFIG 112
             |..::|||.||||:..:::||||::||:|
plant    88 -FKDLAPERAFADFVLCNLVLHLVIINFLG 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:280306 49/94 (52%)
DAD2NP_850247.1 DAD 10..116 CDD:280306 49/94 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1027
Inparanoid 1 1.050 111 1.000 Inparanoid score I2009
OMA 1 1.010
OrthoDB 1 1.010 D1586516at2759
OrthoInspector 1 1.000 T124988
orthoMCL 1 0.900 OOG5_129124
Panther 1 1.100 O PTHR10705
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.