DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dad1 and dad1

Sequence 1:NP_609222.1 Gene:Dad1 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001093909.1 Gene:dad1 ZFINID:ZDB-GENE-060503-233 Length:113 Species:Danio rerio

Alignment Length:107 Identity:73/108 (68%)
Similarity:87/108 (81%) Gaps:0/108 (0%)


  Fly     6 SVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCFVLAV 70
            ||||:|..:|..:|..|||::|.||.||||||:.||:||.||||||||||||||||.|..|:|||
Zfish     7 SVISRFVEEYRSSTLTKLKVIDAYLLYILLTGVFQFLYCLLVGTFPFNSFLSGFISCVGSFILAV 71

  Fly    71 CLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFIG 112
            |||:|.|||||..|..:||||.||||:|||.:|||||:||:|
Zfish    72 CLRIQINPQNKGDFLTVSPERAFADFLFAHTVLHLVVVNFVG 113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:280306 72/106 (68%)
dad1NP_001093909.1 DAD 7..113 CDD:280306 72/106 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C227282636
eggNOG 1 0.900 E1_KOG1746
Hieranoid 1 1.000
Homologene 1 1.000 H1027
Inparanoid 1 1.050 156 1.000 Inparanoid score I4193
OMA 1 1.010
OrthoDB 1 1.010 D1586516at2759
OrthoFinder 1 1.000 FOG0003847
OrthoInspector 1 1.000 T1053670
orthoMCL 1 0.900 OOG5_129124
Panther 1 1.100 LDO PTHR10705
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R877
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.