DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dad1 and dad1

Sequence 1:NP_609222.1 Gene:Dad1 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001016940.1 Gene:dad1 XenbaseID:XB-GENE-922821 Length:113 Species:Xenopus tropicalis

Alignment Length:111 Identity:78/112 (70%)
Similarity:95/112 (85%) Gaps:0/112 (0%)


  Fly     2 VELSSVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCF 66
            |.:.||:|:|.::||.:||::|||:|.||.||||||.:||:||.||||||||||||||||:|..|
 Frog     3 VSVLSVVSRFLDEYVSSTPQRLKLLDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGFISSVGSF 67

  Fly    67 VLAVCLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFIG 112
            :|.||||:|.||||||.|.||||||.||||:||:.||||||:||||
 Frog    68 ILGVCLRIQINPQNKSDFQGISPERAFADFLFANTILHLVVINFIG 113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:280306 76/107 (71%)
dad1NP_001016940.1 DAD 12..113 CDD:307979 73/101 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C227281449
eggNOG 1 0.900 E1_KOG1746
Hieranoid 1 1.000
Homologene 1 1.000 H1027
Inparanoid 1 1.050 165 1.000 Inparanoid score I3969
OMA 1 1.010
OrthoDB 1 1.010 D1586516at2759
OrthoFinder 1 1.000 FOG0003847
OrthoInspector 1 1.000 T1060473
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R877
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.