DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dad1 and ost2

Sequence 1:NP_609222.1 Gene:Dad1 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_593898.1 Gene:ost2 PomBaseID:SPAC6F6.05 Length:122 Species:Schizosaccharomyces pombe

Alignment Length:116 Identity:50/117 (43%)
Similarity:71/117 (61%) Gaps:11/117 (9%)


  Fly     4 LSSVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCFVL 68
            |||||:    .|.:||...||.:|.:||::::.|.:||.|..||||:|||||||||||.|..||:
pombe    11 LSSVIT----SYNENTNLSLKTIDAFLGFLVVVGGLQFGYALLVGTYPFNSFLSGFISCVGQFVI 71

  Fly    69 AVCLRLQANPQ------NKSVFAGISP-ERGFADFIFAHVILHLVVMNFIG 112
            .|..|:....|      :|.....:|| :|.|.:|.|:.::||...:||:|
pombe    72 TVGFRMALTQQELQSSSSKKKSPVVSPYKRAFLEFCFSSLVLHFFAVNFLG 122

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:280306 48/114 (42%)
ost2NP_593898.1 DAD 11..122 CDD:280306 49/115 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1744
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003847
OrthoInspector 1 1.000 T1125430
orthoMCL 1 0.900 OOG5_129124
Panther 1 1.100 LDO PTHR10705
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R877
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.