DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dad1 and Dad1

DIOPT Version :9

Sequence 1:NP_609222.1 Gene:Dad1 / 34159 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001380736.1 Gene:Dad1 / 192275 RGDID:621028 Length:130 Species:Rattus norvegicus


Alignment Length:124 Identity:77/124 - (62%)
Similarity:90/124 - (72%) Gaps:17/124 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCFVLA- 69
            ||||:|..:|:.:||::|||:|.||.||||||.:||.||.||||||||||||||||.|..|:|| 
  Rat     7 SVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAG 71

  Fly    70 ----------------VCLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFIG 112
                            ||||:|.|||||:.|.||||||.||||:||..|||||||||:|
  Rat    72 HQAHKWYTDLHEDKIPVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:396608 76/122 (62%)
Dad1NP_001380736.1 DAD 7..130 CDD:396608 77/124 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339758
Domainoid 1 1.000 162 1.000 Domainoid score I3899
eggNOG 1 0.900 - - E1_KOG1746
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1027
Inparanoid 1 1.050 162 1.000 Inparanoid score I4120
OMA 1 1.010 - - QHG54385
OrthoDB 1 1.010 - - D1586516at2759
OrthoFinder 1 1.000 - - FOG0004116
OrthoInspector 1 1.000 - - oto95658
orthoMCL 1 0.900 - - OOG6_103289
Panther 1 1.100 - - LDO PTHR10705
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2855
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.